Sequence of DPV Sphaeropsis sapinea RNA virus 1

Sphaeropsis sapinea RNA virus 1, complete genome.

ACC No: AF038665

Dated: 1999-02-03 | Length: 5163 | CRC: -230469467

                !!NA_SEQUENCE 1.0
ID   AF038665   standard; RNA; VRL; 5163 BP.
XX
AC   AF038665;
XX
SV   AF038665.1
XX
DT   31-OCT-1998 (Rel. 57, Created)
DT   03-FEB-1999 (Rel. 58, Last updated, Version 2)
XX
DE   Sphaeropsis sapinea RNA virus 1, complete genome.
XX
KW   .
XX
OS   Sphaeropsis sapinea RNA virus 1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-5163
RX   MEDLINE; 99097445.
RA   Preisig O., Wingfield B.D., Wingfield M.J.;
RT   "Coinfection of a fungal pathogen by two distinct double-stranded RNA
RT   viruses";
RL   Virology 252(2):399-406(1998).
XX
RN   [2]
RP   1-5163
RA   Preisig O., Wingfield B.D., Wingfield M.J.;
RT   ;
RL   Submitted (15-DEC-1997) to the EMBL/GenBank/DDBJ databases.
RL   Genetics, University of Pretoria, Hill Crest, Pretoria 0001, South Africa
XX
DR   SPTREMBL; Q9YXE6; Q9YXE6.
DR   SPTREMBL; Q9YXE7; Q9YXE7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5163
FT                   /db_xref="taxon:73497"
FT                   /organism="Sphaeropsis sapinea RNA virus 1"
FT   CDS             80. .2581
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YXE7"
FT                   /evidence=NOT_EXPERIMENTAL
FT                   /note="ORF1"
FT                   /product="coat protein"
FT                   /protein_id="AAD11600.1"
FT                   /translation="MPPISTAQWYHSLLLKSLFVNRFRQSSLFGGRVPLIPNTTIDGYI
FT                   TTHQHHTTPNFPMEHALRNAFLAAVIASPRGGTLLTAPTKKGKEKKAPLATYRRYRANI
FT                   RTESTIAGNVDARVAGIQYEIGARYERVGEAFAPVPEEQVLFEAAYPSSAALAEDFVGF
FT                   ARKYSNFSATFAHSSLAGLVERVARTLGALTVFPSGTFDQDAIRGGRPLMIAALGTLDG
FT                   PVNSLAGSVFIPRLVDSVISPDVFTILINAAAGEGSRVITDVLELDATTRRPIVPTLRD
FT                   SSMLLPCVEALRILGANMAACDQGPLFAFALVRGLNAVLSLVGHTDEAGVTRDIFRVSG
FT                   FDIPFGGIHFGLEPYAGLPAVASNAGADACCYVDALLMTSGALVAHCDPGQEYGGRWFP
FT                   TVLQGTGPDTAEVRPGQSQEGTADMANRNRGLLASSMPRFAEHYARGLGRLFAIEGDAR
FT                   IVVNILSASARLLPDNCRHLRYPSVSPYFWVEPTSLLPPDFLGTAAELNGCGSLAMRGT
FT                   SRTRQAWEDIERVGDEDVTFTGYNVAMPFARSSWFLIHWLNHPANGLGALRVRQLDPNG
FT                   VIHPGPCADNPDVRDRVEASLPITDYLWVRGQSPFPAPGEFLNLTGTLGLLARHLTMDD
FT                   DGIPTEEHLPTGREFRDTAVTVVAGRPVGLPNGAHNAYDSQARRARTRATRELAASAAR
FT                   ARLYGRATVAEMPILTSAPVLRAAPPRPEAVNPMEGGGPGHDLARHSGMGRHTYPPDRE
FT                   QRGDPAVPVPQHQALRAPQMPRPGPNPQGGGVIPPPPPLPPSGGGDGSGPSSGGSCAQE
FT                   DTNPAPPVAPGPAQPDGPANE"
FT   misc_feature    251
FT                   /note="alternate position for initiation methionine"
FT   CDS             2574. .5090
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YXE6"
FT                   /note="ORF2"
FT                   /product="RNA dependent RNA polymerase"
FT                   /protein_id="AAD11601.1"
FT                   /translation="MNKFIDRAEQFGPVGDYLLSVVERFPTVHSYGELSFVDALTRLRA
FT                   MSNNLHANDALLPAAVSLLCLPFPLQVEMSRADVYALLVKGTSLPFNFVRSTAHLHPLP
FT                   DDVGRPGSTRYSGRFFARLLNDHSFRRSCFPTKKMLPAEVKPNLALAPLIRSFSTCAGP
FT                   TLAGHFLRHLAGHVTEDVAMAAMVYAHGLVACYGQKGYDIAAWLVLRPAAAKGISTAIK
FT                   ALGANAHDFGAVLCEAQTLLGRAVSTIDLAHEAEYRCDPDLVAKQVIEPGEELRSHIRA
FT                   VLAMELAGRDLSLPDLDSWWSSRWLWCVNGSQNDASSRLLGIDTARFREFHTREYRRMA
FT                   SEALTHEPITSWDGYTNISASPKLEHGKTRAIFACDTRSYFAFEWLLGATQKAWRNHRV
FT                   LLDPGGGGHLGISRRVRSFMKHGGVNLMLDFDDFNSHHSLNSQRMLFGELCDRANAPGW
FT                   YRKVLSDSWGKMHVNIAGHMRPWLGTLPSGHRGTTIVNSVLNAAYIRMALGGPAFDKLT
FT                   SLHTGDDVYIRADTLTSCEWILDRVRSVGCRINPAKQSVGFGTGEFLRMAITQRETRGY
FT                   LARSVASFVSGNWTNQNPLDPADALRTAIVSTRALINRSGRQDYARLVGPALRLSHPLG
FT                   TRNIIRLLSGDVALDDGPVYNTDGRIVHFRVEGQIEDALPVSERWPHNATDAYLLSHVS
FT                   EVERAALAATGTDAAALMLASSFSKGHSSLGSARRQVVRVAKRETTRAHGFADASDLLH
FT                   RDRDKVGVLKAYPLVNLVKNRLRKETISELLILAGHTPGADPYRQAFGEHPESKNIIGS
FT                   LSHSDASALGKATRSGNIYTLTPVFV"
XX
SQ   Sequence 5163 BP; 916 A; 1725 C; 1459 G; 1063 T; 0 other;

AF038665  Length: 5163  December 21, 2001 14:50  Type: N  Check: 6283  ..

       1  ggatttcacg tacaacgtag ggttgtcctt acgcgttgcg cgcaaggtca
      51  gacaggacgg gcttgtctgg tttcggttga tgccacctat ttccaccgcc
     101  cagtggtacc actcactctt actgaaaagt ttgttcgtga accggtttag
     151  gcaatcgtca ttgttcgggg ggagggttcc gttgatcccc aacacgacga
     201  ttgacggcta cattaccaca caccagcacc acacaacccc gaactttccg
     251  atggagcacg cgctccgcaa cgcattcctc gccgcggtta tcgcctcgcc
     301  gcggggagga acactcttga ccgcaccgac aaagaaaggg aaagagaaga
     351  aggcgccact cgcgacttac cggcgctacc gtgcgaatat tcgtacggag
     401  tcaaccatcg ccggtaatgt cgacgcgcgt gtggctggca tccaatacga
     451  gattggagct cgctacgaac gcgtagggga ggctttcgct cccgtccccg
     501  aagagcaggt tctcttcgag gcggcttatc cgtcctccgc ggccttggcc
     551  gaggacttcg tcggattcgc gcggaagtac tccaacttct ccgccacttt
     601  cgcccactcc agcctcgctg ggttggtcga aagagtcgcg cgcacactgg
     651  gtgcgctaac cgtcttcccg tccggtactt tcgaccagga cgcgattcgc
     701  ggggggcgcc cactgatgat cgcggcgctt ggcactctgg acgggccggt
     751  caattcgttg gccggttccg tcttcatacc ccgactcgtg gacagcgtca
     801  tttcgcctga cgttttcacc atcctgatca acgccgctgc cggtgagggc
     851  agccgcgtca tcacggatgt cctcgagctg gatgccacga ccaggaggcc
     901  tattgtcccg actcttcggg actcgagcat gctcctcccc tgtgtcgagg
     951  ccctccggat cctcggggct aacatggcgg cctgtgacca ggggccgctc
    1001  tttgcctttg cactggtccg cggtctcaac gccgtcttgt ctcttgtcgg
    1051  acatactgac gaggctggcg tgacccgcga catcttccgg gtctccgggt
    1101  tcgatatccc ctttggcggg attcatttcg gactggagcc ttacgccgga
    1151  ctgccggcgg tcgcttcgaa cgcgggtgct gacgcctgct gctacgtgga
    1201  cgcgctcctg atgacgtctg gagccctcgt agcccattgc gaccctggcc
    1251  aggaatacgg gggacgttgg ttcccaactg tcctccaagg gactggtccc
    1301  gacaccgctg aggtgcgccc gggacagtct caagagggta cggccgatat
    1351  ggctaaccgt aaccgcgggc tgctcgcttc gagtatgccg cggttcgccg
    1401  agcactacgc ccgtgggctc ggtcgcctct tcgctatcga gggtgatgcg
    1451  cgcatcgtcg tgaacatcct cagcgcgtcg gcccgcctct tgcccgacaa
    1501  ctgccgccac ttgcggtacc cctccgtctc gccctatttt tgggtcgagc
    1551  ccacttctct gctgcccccc gacttcttag ggacggcggc agagctcaat
    1601  gggtgtgggt cccttgcaat gcgtggcacc tcccgaaccc gccaggcttg
    1651  ggaggacatc gaacgagtgg gtgacgaaga cgtcactttc acggggtaca
    1701  acgtggcgat gcctttcgcc cggtcctcgt ggttcctcat ccactggctc
    1751  aaccaccccg ccaacgggct cggcgctttg cgtgtgcgcc agctcgaccc
    1801  gaacggggtc attcacccgg ggccttgcgc tgacaatcct gacgtccggg
    1851  atcgcgttga ggcctccctg cccattacgg actatttgtg ggtccggggg
    1901  caatctccct tccccgcgcc tggtgagttc ctgaacttga ccgggacgtt
    1951  gggactcctc gcccgccacc tgaccatgga cgacgacggg attccgaccg
    2001  aggaacacct ccccaccggg agggaatttc gcgacactgc ggtcacggtt
    2051  gttgcggggc gtccggtggg cctccctaat ggggcccaca acgcctacga
    2101  ctctcaagct cgtcgcgccc gaacccgcgc gacccgcgag cttgcggcct
    2151  ccgctgcacg cgcccgtctt tacggccggg ccaccgtagc ggagatgccg
    2201  atactgacca gcgcgcctgt tttgcgcgct gcgccaccac ggccagaagc
    2251  cgtaaacccg atggagggtg gggggccagg acacgacctg gcgcgtcatt
    2301  cagggatggg tagacacact tacccccctg accgcgaaca acgcggcgac
    2351  cccgcagtgc cggtgccaca gcaccaggcc ctgcgcgccc ctcagatgcc
    2401  acgccccggc ccgaacccgc agggcggcgg cgtgatcccg cccccccccc
    2451  cgcttccgcc gtcaggtgga ggtgacggtt ctggccccag tagtggtggc
    2501  tcctgtgctc aggaggacac caaccctgcc ccccctgtag cacccggccc
    2551  cgcccagcct gacgggcccg ccaatgaata agttcattga cagggccgaa
    2601  caattcggcc cggtgggtga ctacctacta tcggttgtcg aacgcttccc
    2651  gacggtacat tcttacggtg aactctcttt cgttgatgcc cttacccggt
    2701  tgcgtgctat gtccaataac ttgcacgcga acgacgcgct gctgcctgcc
    2751  gctgtgtctc ttctctgcct gccgttccct ctgcaggtcg agatgtcacg
    2801  cgccgacgtg tatgcactgc tcgtaaaggg cacgtccctt cctttcaact
    2851  ttgtacgttc caccgcccac ttgcaccccc tgcctgatga cgttggccgg
    2901  ccgggttcca ctcgttacag tgggcggttc tttgcgcgtt tgcttaatga
    2951  ccactctttc cggcgttctt gttttccaac gaagaagatg ttgccagcag
    3001  aggttaaacc caacctcgcc ctggcgcctc tcatccgctc gttttccacg
    3051  tgtgccggac ccaccctggc cggtcatttc ctacgtcacc tagctggaca
    3101  cgtgaccgag gacgtcgcga tggctgccat ggtatatgcc cacggcctcg
    3151  tcgcctgcta cggacagaag ggctacgata tcgcagcctg gcttgtctta
    3201  aggcctgcgg cggctaaggg catctcgacg gctatcaagg ctctcggcgc
    3251  gaacgcccat gacttcggtg ctgtcctctg tgaagctcag actttactcg
    3301  gacgcgccgt ctctacaatc gacctagccc acgaggcgga ataccgctgt
    3351  gaccccgatc tcgtggccaa gcaggtcata gaacccggtg aagagttacg
    3401  ctcccacata cgcgccgtcc tcgcgatgga gctcgctgga cgagacctct
    3451  ctctgcccga cctcgactcg tggtggtctt ctcgctggtt gtggtgtgtg
    3501  aacggttccc agaacgacgc ttcctcgcgc cttctcggga tcgacactgc
    3551  ccgtttccgc gagttccaca cgcgtgagta ccggaggatg gcttccgaag
    3601  cgttaactca cgaaccaatc acgagctggg acgggtacac gaatatctcg
    3651  gcttccccca aattggaaca cgggaaaacc cgagctatct tcgcttgcga
    3701  cacccgcagc tacttcgctt tcgagtggtt gcttggcgct acacaaaaag
    3751  cctggcgtaa ccaccgagtt ctgctcgacc ctggtggtgg cgggcatctt
    3801  ggcatatctc gacgtgtccg tagtttcatg aaacacggcg gggtgaacct
    3851  gatgctcgac ttcgacgact tcaactccca ccactctctc aacagccaac
    3901  gcatgctctt cggtgagctt tgtgaccgtg cgaacgcccc cggatggtac
    3951  cgaaaggtgc tttccgattc ctgggggaaa atgcacgtaa acatcgccgg
    4001  tcacatgcgt ccatggcttg gtacgcttcc ctctggccac cgggggacga
    4051  ccatcgttaa ctcagtgcta aacgcggctt acatccgcat ggcactaggt
    4101  ggccccgcct tcgacaaact cacctccctc cataccggcg acgacgtcta
    4151  catcagggct gacaccctga cctcgtgtga gtggatcctt gaccgtgtcc
    4201  gctccgtcgg ttgtcgcatt aaccccgcca agcagagcgt gggttttggg
    4251  actggtgagt tcctccggat ggcgattacc cagcgagaaa cgagagggta
    4301  cctcgctcgg tcggtggcct catttgtctc aggcaactgg accaaccaaa
    4351  accctctcga ccccgccgac gccttacgaa ctgcgatcgt ctctacgcgt
    4401  gctctgatca atcgatcagg gcggcaagac tacgcacgac tcgtgggccc
    4451  ggcattacgc ctatcccacc ccctcggcac gcgcaacatc atccggttac
    4501  tcagcggtga tgtggcactc gacgacggcc ccgtctacaa cacagacggc
    4551  cgcatcgtgc atttccgggt ggaagggcaa attgaggacg cgctccctgt
    4601  ctccgaacgc tggcctcaca acgccaccga cgcgtacttg ttatcgcacg
    4651  tgtcggaggt ggaacgcgcc gccctcgcgg cgaccggcac tgacgctgcc
    4701  gccttgatgc ttgcctctag cttttcaaaa gggcattcat cattaggcag
    4751  tgctcggcgc caggttgtca gggtagcaaa gcgggaaacc acccgcgccc
    4801  atggtttcgc agatgcttct gatctactgc accgtgaccg tgacaaagtc
    4851  ggggtattga aggcataccc cctcgtcaac ttggtaaaga accgccttcg
    4901  taaggagaca atatcagaac tgctcatcct cgccggccat acgcctggcg
    4951  ccgacccgta ccgacaagcc tttggtgaac acccagagtc aaagaacatc
    5001  atcggctcgt tatcgcactc ggacgccagc gcgttgggca aggcgacgcg
    5051  ttctggtaac atatacaccc tcacccccgt gttcgtttag tcagagacga
    5101  gcattggccg ccccaaccag accggggcaa catactagtg ggcccgctgg
    5151  ggccaaactg cag