Sequence of DPV Sphaeropsis sapinea RNA virus 2

Sphaeropsis sapinea RNA virus 2, complete genome.

ACC No: AF039080

Dated: 1999-02-03 | Length: 5202 | CRC: -508568803

                !!NA_SEQUENCE 1.0
ID   AF039080   standard; RNA; VRL; 5202 BP.
XX
AC   AF039080;
XX
SV   AF039080.1
XX
DT   31-OCT-1998 (Rel. 57, Created)
DT   03-FEB-1999 (Rel. 58, Last updated, Version 2)
XX
DE   Sphaeropsis sapinea RNA virus 2, complete genome.
XX
KW   .
XX
OS   Sphaeropsis sapinea RNA virus 2
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-5202
RX   MEDLINE; 99097445.
RA   Preisig O., Wingfield B.D., Wingfield M.J.;
RT   "Coinfection of a fungal pathogen by two distinct double-stranded RNA
RT   viruses";
RL   Virology 252(2):399-406(1998).
XX
RN   [2]
RP   1-5202
RA   Preisig O., Wingfield B.D., Wingfield M.J.;
RT   ;
RL   Submitted (17-DEC-1997) to the EMBL/GenBank/DDBJ databases.
RL   Genetics, University of Pretoria, Hill Crest, Pretoria 0001, South Africa
XX
DR   SPTREMBL; Q9YXE4; Q9YXE4.
DR   SPTREMBL; Q9YXE5; Q9YXE5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5202
FT                   /db_xref="taxon:73498"
FT                   /organism="Sphaeropsis sapinea RNA virus 2"
FT   CDS             296. .2665
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YXE5"
FT                   /note="ORF1"
FT                   /product="coat protein"
FT                   /protein_id="AAD11602.1"
FT                   /translation="MAEAPASHHRYPAPLVGTLADPQGGGLAADNQFRRYRAALRIRAP
FT                   DRGNYLTSTRSIFYEVGRRYGSGGDALAPPPEAAMRIDCSVPINPAEAANFEGLARRFS
FT                   NFSPQWEMMDLAAIAERLAKGVAAASVYGQGLDTQALRAGQPIRVVALGTLDSPQTAST
FT                   ASVFIPRTVDAVSNDHVFAVLCAAANGAGAAVTTDVLRLDANTNQPIVPAVTGAAFTTA
FT                   CVEALRMVGANMEASGAGDVFAYAVTRAIHSIVSVVAHTDEGGIMRGLLRHDAFRVPYG
FT                   GINQALRQYPGLPPLASVAQSAVSAWVDAIALKTAAVVAHCDPLVPGAGGLFPTVFVSR
FT                   GDVPAAPGTAEGDITDAQALSVARQMAADLGRFAPMYMRALTMIFGLRSNSAIAEQHFC
FT                   TAGARYLDQDGHRIDRHLRHGTVAPYFWVEPTSLIPHDFLGTAAEAADYAAKCSPMGGV
FT                   RSQPLFEEHRILGHGATANHMSLAFKMRSARTSAFVAAYAASPSVLGNFRLYQFDSASV
FT                   VLPGDQGPTNGTVADKHAAADPLSSYLWVRGQSAIPAPAEFMNTQSAYGAKVRLIKWDD
FT                   DWDATRTDAPDEMDFQGSIDWAVTVPTGLAIGASNAPDRAAKRARTRAATALAQVLQQM
FT                   RGAGPASSPVMEISDVPPDFGGAREEYRNTNNNVFAGNPGAGVIGGEAGAVAPQVPAHR
FT                   GPPLGPTTHHQALRAPQLPRPGQAGAGGGGAAPPPLPPLVATPFPFFRRPPEETMTALA
FT                   ARPLPFRLPLTRSPSPTTPLPLKAPTVKYRRRPRNE"
FT   CDS             2658. .5135
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YXE4"
FT                   /note="ORF2"
FT                   /product="RNA dependent RNA polymerase"
FT                   /protein_id="AAD11603.1"
FT                   /translation="MSNDRLHSRVEATGPVGVYLRSLVPLELAAVVSRLPFDRQISFIY
FT                   SPQWQGRRPTGIQRLAGAFLLPQVPVQVSVTDADLLLLLTNTLPPAFPKRIHRQAGWSY
FT                   SDRATLAEFGLKSNPAASNKVNVYLCEVMRSLSDYSTSWAWLAEDALSRAPPMFNDQAS
FT                   ALVLYGTALQAKGVQNGYHAATALIANPEYAKDMTTVLKAVGANSNHLGACLVEAQTLQ
FT                   GRAVQPADMHSEAISRTTTAVADIVVDYPDDVLRSHIRTVLEREIQRVGDSHAIEYPTL
FT                   QEHWDSRWLWAVNGSQSGLLSREHLEAAPRPPGAAREYRAVMARESEQDPRPAWDGHTY
FT                   VSGSPKLEHGKTRAIFACDTLNYLAFEHLLASVESRWRGERVVLNPGRGGNVGMSFRVA
FT                   AARQRAGISLMLDYDDFNSHHSIRAMQILFEETAALTHYPPELAAKLVASFENMDLYLG
FT                   SSCIGRVLGTLMSGRRGTTYISSVLNEVYLAIELGASWLAERPSIHVGDDVYLGVRTYR
FT                   DAAYVLDKCATSRLRMNPMKQSVGHTSTEFLRLACAGRATYGYLARAVASTISGNWVTE
FT                   EALDPYDGLTSMLTNARSLANRASSPFLPLLLRRSVQRITKLPRPDHKKIDQLLTGQLA
FT                   LENGPMFSQGAEYVWVDASSVQPPPDEWGYQDLPLAATTQFLSRCAQPLEVKYLTEAGI
FT                   GLTAVMAEASYRKTFSSTFSRSDRVILGPVRRRPVAGTASVERLLNTRPPEGCLEKYPL
FT                   LRLARRRLPRSVLQRAIAEAGGNPDAADLDLEAWGEHNHGCVVATPLSYADAATYGRRT
FT                   TCGVLVCGLHFYV"
XX
SQ   Sequence 5202 BP; 923 A; 1770 C; 1508 G; 1001 T; 0 other;

AF039080  Length: 5202  December 21, 2001 14:50  Type: N  Check: 3807  ..

       1  ccagggaccc ctgcagcccc ctgtttgtca gcgcctgtaa tagggtacta
      51  cattgctgca ggctggtagc gtgagcggtc ggtaacactt ccgttctcca
     101  cgccagagtt gcccctcgtg ggcgtgtctg ccggaagggc tgaaaagtat
     151  ccggccggta gctcgccccc gcgcatgtgc ccgaataggg attgggtgcg
     201  cggttgaggg tctggtgtcg taatggggcg aggagggttc cgaagatcca
     251  aaccattaca cacctgcaac tctgattacc atcaccacta gcgccatggc
     301  tgaagctccc gcttcccacc atcgttaccc cgccccttta gtgggcactc
     351  tagccgaccc gcaaggcggg ggtctggctg ctgacaacca gttccgccga
     401  taccgtgccg cgctccgcat ccgtgctccg gaccgtggta actacctcac
     451  gagcacgcgt tcgatcttct acgaagtcgg acgacgctac ggcagcggcg
     501  gcgatgccct tgcccctcct ccggaggcgg ctatgcgcat cgactgttcg
     551  gtgccgatca atccggcgga ggccgccaac tttgagggcc tcgcacgtcg
     601  gttctccaac ttctccccgc aatgggagat gatggacctc gctgccatcg
     651  ccgagcgatt ggctaaaggt gtcgcggccg cgtccgttta cggacaaggc
     701  ttagacacgc aggcgctgcg cgcggggcag cccattcgcg tggtcgctct
     751  ggggactctt gactcgcccc agacggcgtc gaccgcgtcc gtgttcatac
     801  cgcggacggt cgacgctgtg tcgaacgacc acgtcttcgc agtcctatgc
     851  gccgccgcca acggtgctgg ggctgcggta accaccgacg tcctcaggct
     901  ggatgccaat actaaccagc cgatagtgcc cgccgtcacc ggggccgcct
     951  tcaccactgc ttgtgttgag gccctccgca tggtcggcgc aaacatggag
    1001  gcgtcgggcg caggcgatgt tttcgcctac gccgtcacca gggctatcca
    1051  cagcatcgtg agcgtggtgg cccacaccga cgagggcggt atcatgcgcg
    1101  ggcttctccg ccatgatgct ttccgcgtcc cgtacggagg gatcaaccaa
    1151  gccctccgtc aataccctgg ccttccgccg ctcgcgtcgg tggcccagag
    1201  tgctgttagc gcctgggtcg acgcgatcgc actgaagacc gcggccgtgg
    1251  tcgcccactg cgaccccctc gtccccggcg ccggcgggct gttcccaaca
    1301  gtcttcgtca gccgtggtga cgtgcccgct gcgccaggta cagccgaggg
    1351  cgacatcacg gacgcccagg ccctctcggt cgcgcggcag atggccgccg
    1401  acctaggtcg gttcgcgccg atgtacatgc gggccctgac catgatcttc
    1451  ggattgcggt cgaacagcgc catcgctgag cagcacttct gcacagcggg
    1501  ggcccgctat cttgaccagg acggtcaccg catcgaccgt cacctccgtc
    1551  atgggaccgt cgcgccctac ttctgggtcg agccgacgtc cctcatcccc
    1601  catgacttct tggggacagc tgcagaagcg gctgattacg cggctaagtg
    1651  ctcccctatg ggtggagttc ggtcgcaacc cttgttcgag gaacaccgca
    1701  tcctcggaca tggcgccact gccaaccaca tgtcgttggc tttcaagatg
    1751  cgctctgcac gtacgagcgc gttcgtggca gcctacgcag cgagcccgtc
    1801  agttctcggt aacttcaggc tctaccagtt cgactcggct tcggtcgtcc
    1851  tccccggcga ccagggccct acgaacggta ccgtggctga caaacacgcg
    1901  gccgccgacc ctttgtcctc gtacctctgg gtgcgaggcc agtcggccat
    1951  cccagccccg gctgagttta tgaacactca gtcggcctac ggcgccaagg
    2001  tccgtctcat caagtgggac gacgactggg atgctacgcg tacggacgcg
    2051  cccgatgaaa tggacttcca ggggtccatc gattgggccg tcacggtacc
    2101  gaccggcctg gctattgggg ccagtaacgc gccggaccgt gcagctaagc
    2151  gtgcacgcac ccgcgctgcg accgcacttg cccaagtgct gcagcagatg
    2201  cgcggtgccg ggccggcttc atcgccggtc atggagatat cggatgtccc
    2251  acctgatttc ggtggggcac gggaggaata ccgcaacacg aacaataacg
    2301  tgtttgcggg caaccctggg gcgggtgtca tcggtgggga agccggtgcg
    2351  gtcgcccctc aggtaccagc ccaccgtggt ccgcccctcg ggccgaccac
    2401  gcaccaccag gcgctccgtg cgccccaact gccacgcccg ggccaggctg
    2451  gcgctggtgg tggcggtgcc gcccctcctc ccctcccccc cctggtggca
    2501  acccccttcc ccttcttccg ccgccccccg gaggaaacaa tgacggccct
    2551  ggcggcccgc cccctcccgt tccgcctccc gttgacccgg tccccatccc
    2601  ccacaacccc cctgccgctg aaggcgccga cggtaaagta ccgccggcgc
    2651  ccccgcaatg agtaacgaca gactccactc gcgggtagag gccacaggtc
    2701  ccgtgggtgt gtatttacga tcgcttgtgc ctctagaatt agcggcggtt
    2751  gtctcccgtt tgccgttcga tcggcagatt tctttcattt atagccctca
    2801  gtggcaaggc cggcggccca ccggcataca gcgtttagca ggcgccttcc
    2851  tgctaccaca ggtccccgtt caggtgtcag taactgacgc ggacctcctc
    2901  cttctactga ctaacactct cccccccgcc tttccgaagc ggatccaccg
    2951  ccaggcgggg tggtcataca gcgaccgtgc taccctcgca gagttcggat
    3001  tgaaatccaa cccagccgcc tctaataagg taaatgtgta cctttgcgag
    3051  gtcatgcggt cactttctga ctactcgacg agttgggctt ggctcgccga
    3101  ggacgccctt tcacgcgcac cgccgatgtt taatgatcag gcgagcgcgc
    3151  tagtactata tggtacggcc ctccaggcaa agggcgtgca gaacggttac
    3201  cacgccgcaa ctgcactaat tgccaacccg gaatacgcaa aagatatgac
    3251  tacggtgctc aaggccgtag gcgcgaattc caaccacctc ggtgcctgcc
    3301  tcgtcgaagc tcagacgttg caggggcgtg ccgtccaacc ggccgacatg
    3351  cactccgagg ccatctccag gactacgact gccgttgctg acatcgtggt
    3401  cgactatcca gatgatgtcc ttcgttcaca catccggact gtccttgagc
    3451  gtgagatcca acgagtcggc gactcccacg ccatcgagta cccaacctta
    3501  caagaacatt gggactctcg atggctctgg gcagtcaacg gctcacaatc
    3551  cgggttgctc tctcgcgagc atctcgaagc tgccccccga ccgccggggg
    3601  ccgcgcgcga atacagggcg gtcatggctc gagagagtga gcaagacccc
    3651  cggccagctt gggacgggca cacgtatgtg tccggttctc ccaaactgga
    3701  gcatgggaaa acccgggcta tcttcgcttg tgacactctc aactacttgg
    3751  cgttcgaaca cttactcgcg agcgtcgagt cccgttggcg cggtgagcgc
    3801  gtcgtcctca accctggccg aggtggtaac gtcggaatgt cattccgcgt
    3851  cgccgccgca cgccagcgtg ccggcatctc tttgatgctg gattacgatg
    3901  acttcaactc ccaccactca atccgcgcca tgcaaatact cttcgaggag
    3951  actgcggcat taacccacta cccgcctgag ctcgcggcta agcttgtagc
    4001  ctccttcgaa aatatggacc tgtacttagg gtcctcctgt atcggccgcg
    4051  tccttgggac gctcatgtct ggacgccgcg ggacgactta catcagctcc
    4101  gtcctgaacg aggtctacct cgccatcgag ctaggagcct cttggttagc
    4151  tgagcgcccg tcaatccatg taggtgacga cgtctacctt ggcgtccgca
    4201  cttaccgaga cgcggcttac gtactcgaca agtgcgccac gtcacgccta
    4251  cgcatgaacc cgatgaaaca gtccgtcgga cacacgtcga cggagttcct
    4301  gcgtctagcg tgcgccggtc gcgcaaccta cggctatctc gcccgggccg
    4351  tagcatcaac tatttcgggc aactgggtaa cggaggaggc cttagacccc
    4401  tatgacgggc tcacctccat gctcacgaac gcgcggtcct tggctaaccg
    4451  cgccagctct cccttcttgc ctctgctctt gcgtcgtagc gtccagcgaa
    4501  tcactaagct accacggccg gaccacaaga agatcgacca gctgcttact
    4551  ggccagcttg ccctcgagaa cgggcctatg ttctcacaag gtgctgagta
    4601  cgtatgggta gacgcgagct cagtacagcc ccctcccgac gagtgggggt
    4651  atcaagacct acccttagct gcaacgacac agttcttaag ccgttgcgcc
    4701  caaccgctcg aggtcaagta cctcactgaa gcggggattg gccttactgc
    4751  cgtgatggcg gaggcgagtt accgtaagac gttctcgtcc acgttctccc
    4801  gtagtgaccg cgtgatcctc ggcccagtga ggcgcagacc tgtggctggg
    4851  acggcttccg ttgagcggct cctcaacacg cgcccgccgg aagggtgcct
    4901  tgaaaagtac ccactcctcc gcctcgcccg caggaggttg ccgagatctg
    4951  tactacagcg ggctatcgcc gaggcaggtg gcaatccgga cgccgccgac
    5001  ctcgatctcg aagcatgggg ggaacacaac catggttgtg ttgtcgccac
    5051  cccccttagc tacgccgacg ccgctactta cggtcggcgg acaacatgcg
    5101  gcgtgttagt gtgtggttta cacttctacg tctaaaggtg acacctaacc
    5151  ttactcgcgc ggggcgcgag tccacagcgg gggcctacgg gccccaaatg
    5201  cc