Sequence of DPV Feline leukemia virus

Feline leukemia virus strain Rickard subgroup A, complete genome.

ACC No: AF052723

Dated: 1998-08-17 | Length: 8448 | CRC: -1198177210

                !!NA_SEQUENCE 1.0
ID   AF052723   standard; genomic DNA; VRL; 8448 BP.
XX
AC   AF052723;
XX
SV   AF052723.1
XX
DT   17-AUG-1998 (Rel. 56, Created)
DT   17-AUG-1998 (Rel. 56, Last updated, Version 1)
XX
DE   Feline leukemia virus strain Rickard subgroup A, complete genome.
XX
KW   .
XX
OS   Feline leukemia virus
OC   Viruses; Retroid viruses; Retroviridae; Gammaretrovirus.
XX
RN   [1]
RP   1-8448
RX   MEDLINE; 98362106.
RX   PUBMED; 9696797.
RA   Chen H., Bechtel M.K., Shi Y., Phipps A., Mathes L.E., Hayes K.A.,
RA   Roy-Burman P.;
RT   "Pathogenicity induced by feline leukemia virus, Rickard strain, subgroup A
RT   plasmid DNA (pFRA).";
RL   J. Virol. 72(9):7048-7056(1998).
XX
RN   [2]
RP   1-8448
RA   Chen H., Roy-Burman P.;
RT   ;
RL   Submitted (08-MAR-1998) to the EMBL/GenBank/DDBJ databases.
RL   Department of Pathology, Univ. of Southern California, School of Medicine,
RL   2011 Zonal Ave., HMR 212, Los Angeles, CA 90033, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8448
FT                   /db_xref="taxon:11768"
FT                   /mol_type="genomic DNA"
FT                   /note="from thymic tumor of experimentally challenged cat"
FT                   /proviral
FT                   /organism="Feline leukemia virus"
FT                   /strain="Rickard subgroup A"
FT   LTR             1. .483
FT                   /note="5' long terminal repeat"
FT   CDS             685. .6045
FT                   /codon_start=1
FT                   /db_xref="GOA:O89811"
FT                   /db_xref="HSSP:P03355"
FT                   /db_xref="UniProt/TrEMBL:O89811"
FT                   /transl_except=(pos:2425. .2427,aa:Gln)
FT                   /product="gag-pol precursor polyprotein gPr80"
FT                   /protein_id="AAC31801.1"
FT                   /translation="MSGASSGTAIGAHLFGVSPEYRVLIGDEGAGPSKSLSEVSFSVWY
FT                   RSRAARLVIFCLVASFLVPCLTFLIAETVMGQTITTPLSLTLDHWSEVRARAHNQGVEV
FT                   RKKKWITLCEAEWVMMNVGWPREGTFSLDNISQVEKKIFAPGPYGHPDQVPYITTWRSL
FT                   ATDPPSWVRPFLPPPKPPTPLPQPLSPQPSAPLTSSLYPVLPKSDPPKPPVLPPDPSSP
FT                   LIDLLTEEPPPYPGGHGPPPSGPRTPTASPIASRLRERRENPAEESQALPLREGPNNRP
FT                   QYWPFSASDLYNWKSHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQALLTGEERQ
FT                   RVLLEARKQVPGEDGRPTQLPNVIDETFPLTRPNWDFATPAGREHLRLYRQLLLAGLRG
FT                   AARRPTNLAQVKQVVQGKEETPAAFLERLKEAYRMYTPYDPEDPGQAASVILSFIYQSS
FT                   PDIRNKLQRLEGLQGFTLSDLLKEAEKIYNKRETPEEREERLWQRQEERDKKRHKEMTK
FT                   VLATVVAQNRDKDREESKLGDQRKIPLGKDQCAYCKEKGHWVRDCPKRPRKKPANSTLL
FT                   NLGDQESQGQDPPPEPRITLKIGGQPVTFLVDTGAQHSVLTRPDGPLSDRTALVQGATG
FT                   SKNYRWTTDRRVQLATGKVTHSFLYVPECPYPLLGRDLLTKLKAQIHFTGEGANVVGPK
FT                   GLPLQVLTLQLEEEYRLFEPESTQKQEMDIWLKNFPQAWAETGGMGTAHCQAPVLIQLK
FT                   ATATPISIRQYPMPHEAYQGIKPHIRRMLDQGILKPCQSPWNTPLLPVKKPGTEDYRPV
FT                   QDLREVNKRVEDIHPTVPNPYNLLSTLPPSHPWYTVLDLKDAFFCLRLHSESQLLFAFE
FT                   WRDPEIGLSGQLTWTRLPQGFKNSPTLFDEALHSDLADFRVRYPALVLLQYVDDLLLAA
FT                   ATRTECLEGTKALLETLGNKGYRASAKKAQICLQEVTYLGYSLKDGQRWLTKARKEAIL
FT                   SIPVPKNSRQVREFLGTAGYCRLWIPGFAELAAPLYPLTRPGTLFQWGTEQQLAFEDIK
FT                   KALLSSPALGLPDITKPFELFIDENSGFAKGVLVQKLGPWKRPVAYLSKKLDTVASGWP
FT                   PCLRMVAAIAILVKDAGKLTLGQPLTILTSHPVEALVRQPPNKWLSNARMTHYQAMLLD
FT                   AERVHFGPTVSLNPATLLPLPSGGNHHDCLQILAETHGTRPDLTDQPLPDADLTWYTDG
FT                   SSFIRNGEREAGAAVTTESEVIWAAPLPPGTSAQRAELIALTQALKMAEGKKLTVYTDS
FT                   RYAFATTHVHGEIYRRRGLLTSEGKEIKNKNEILALLEALFLPKRLSIIHCPGHQKGDS
FT                   PQAKGNRLADDTAKKAATETHSSLTVLPTELIEGPKRPPWEYDDSDLDLVQKLEAHYEP
FT                   KRGTWEYRGKTIMPEKYAKELISHLHKLTHLSARKMKTLLEREETGFYLPNRDLHLRQV
FT                   TESCRACAQINAGKIKFGPDVRARGRRPGTHWEVDFTEIKPGMYGYKYLLVFIDTFSGW
FT                   AEAYPAKHETAKVVAKKLLEEIFPRYGIPQVLGSDNGPAFISQVSQSVATLLGINWKLH
FT                   CAYRPQSSGQVERMNRSIKETLTKLTLETGSKDWVLLLPLVLYRVRNTPGPHGLTPFEI
FT                   LYGAPPPMAHFFDTDISSFATSPTMQAHLRALQLVQEEIQRPLAAAYREKLETPVVPHP
FT                   FKPGDSVWVRRHQTKNLEPRWKGPHIVLLTTPTALKVDGVAAWIHASHVKAAGPTTNQD
FT                   LSDSPSSDDPSRWKVQRTQNPLKIRLSRGT"
FT   mat_peptide     907. .2412
FT                   /product="gag gene polyprotein Pr65-gag"
FT   mat_peptide     907. .1287
FT                   /product="virion core structural peptide p15"
FT   mat_peptide     1288. .1497
FT                   /product="virion core structural peptide p12"
FT   mat_peptide     1498. .2241
FT                   /product="virion core structural peptide p27"
FT   mat_peptide     2242. .2412
FT                   /product="virion core structural peptide p10"
FT   mat_peptide     2413. .6042
FT                   /product="pol gene polyprotein"
FT   mat_peptide     2413. .2787
FT                   /product="protease"
FT   mat_peptide     2788. .4794
FT                   /product="reverse transcriptase"
FT   mat_peptide     4795. .6042
FT                   /product="endonuclease/integrase"
FT   CDS             5988. .7916
FT                   /codon_start=1
FT                   /db_xref="GOA:O89812"
FT                   /db_xref="HSSP:P03385"
FT                   /db_xref="UniProt/TrEMBL:O89812"
FT                   /gene="env"
FT                   /product="env gene polyprotein"
FT                   /protein_id="AAC31802.1"
FT                   /translation="MESPTHPKPSKDKTLSWNLAFLVGILFTIDIGMANPSPHQIYNVT
FT                   WVITNMQTNTQANATSMLGTLTDAYPTLHVDLCDLVGDTWEPIVLDPTNVKHGARYSSS
FT                   KYGCKTTDRKKQQQTYPFYVCPGHAPSLGPKGTHCGGAQDGFCAAWGCETTGEAWWKPS
FT                   SSWDYITVKRGSSQDNSCEGKCNPLILQFTQKGRQASWDGPKIWGLRLYRTGYDPIALF
FT                   TVSRQVSAITPPQAMGPNLVLPDQKPPSRQSQTGSKVATQRLQTTESAPRSVAPTTVGP
FT                   KRIGTGDRLINLVQGTYLALNATDPNKTKDCWLCLVSRPPYYEGIAILGNYSNQTNPPP
FT                   SCLSTPQHKLTISEVSGQGLCIGTVPKTHQALCNETQQGHTGAHYLAAPNGAYWACNTG
FT                   LTPCISMAVLNWTSDFCVLIELWPRVTYHQPEYVYTHFAKAVRFRREPISLTVALMLGG
FT                   LTVGGIAAGVGTGTKALLETAQFRQLQMAMHTDIQALEESISALEKSLTSLSEVVLQNR
FT                   RGLDILFLQEGGLCAALKEECCFYADHTGLVRDNMAKLRERLKQRQQLFDSQQGWFEGW
FT                   FNKSPWFTTLISSIMGPLLILLLILLFGPCILNRLVQFVKDRISVVQALILTQQYQQIK
FT                   QYDPDRP"
FT   mat_peptide     6087. .7322
FT                   /gene="env"
FT                   /product="gp70 protein"
FT   mat_peptide     7323. .7913
FT                   /gene="env"
FT                   /product="p15E protein"
FT   LTR             7976. .8448
FT                   /note="3' long terminal repeat"
XX
SQ   Sequence 8448 BP; 2335 A; 2339 C; 1951 G; 1823 T; 0 other;

AF052723  Length: 8448  January 7, 2005 14:54  Type: N  Check: 8129  ..

       1  tgaaagaccc cctaccccaa aatttagcca gctactgcag tggtgccatt
      51  tcacaaggca tggaaaatta ctcaagtatg ttcccatgag atacaaggaa
     101  gttagaggct aaaacaggat atctgtggtt aagcacctgg gccccggctt
     151  gaggccaaga acagttaaac cccggatata gctgaaacag cagaagtttc
     201  aaggccgcta ccagcagtct ccaggctccc cagttgacca gggttcgacc
     251  ttccgcctca tttaaactaa ccaatcccca cgcctctcgc ttctgtgcgc
     301  gcgctttctg ctataaaacg agccatcagc ccccaacggg cgcgcaagtc
     351  tttgctgaga cttgaccgcc ccgggtaccc gtgtacgaat aaacctcttg
     401  ctgattgcat ctgactcgtg gtctcggtgt tctgtgggcg cggggtctca
     451  tcgccgagga agacctagtt caggggtctt tcatttgggg gctcgtccgg
     501  gatcgagacc cccgaccccc gggaccaccg acccaccatc aggaggtaag
     551  ctggccggcg accatacctg ttgtccttgt ataagtgtct ctgtcaattg
     601  atctgatttt ggcggtggga tcgaaggagc tgacgagctc gtacttcgcc
     651  cccgcaaccc tggaagacgt tccacgggtg tctgatgtct ggagcctcta
     701  gtgggacagc cattggggct catctgtttg gggtctcacc tgaatacagg
     751  gtgttgatcg gagacgaggg agccggaccc tcaaagtctc tttctgaggt
     801  ttcattttcg gtttggtacc gaagccgcgc ggcacgtctt gtcatttttt
     851  gtctggttgc gtcttttctt gtcccttgtc taaccttttt aattgcagaa
     901  accgtcatgg gccaaactat aactaccccc ttaagcctca cccttgatca
     951  ctggtctgaa gtccgggcac gagcccataa ccaaggtgtc gaggtccgga
    1001  aaaagaaatg gattacctta tgtgaggccg aatgggtgat gatgaatgtg
    1051  ggctggcccc gagagggaac tttttctctt gataacattt cccaggttga
    1101  gaaaaagatc ttcgccccgg gaccgtatgg acaccccgac caggttcctt
    1151  acattaccac atggagatcc ttagccacag accccccttc gtgggttcgg
    1201  ccgttcctac cccctcccaa acctcccacg cccctccctc aacctctctc
    1251  gccgcagccc tccgcccctc ttacctcttc cctctacccc gtcctcccca
    1301  agtcagaccc tcccaaaccg cctgtgttac cgcctgatcc ttcttcccct
    1351  ttaatagatc tcttaacaga agagccacct ccctatccgg gaggtcacgg
    1401  gccaccgccg tcaggtccta ggaccccaac cgcttccccg attgcaagcc
    1451  ggctaaggga acgacgagaa aaccctgctg aagaatctca agccctcccc
    1501  ttgagggagg gccccaacaa ccgaccccag tattggccat tctcagcctc
    1551  agacctgtat aactggaagt cgcataaccc ccctttctcc caagacccag
    1601  tggccctaac taacctaatt gagtccattt tagtgacgca tcaaccaacc
    1651  tgggacgact gccagcagct cttgcaggca ctcctgacag gcgaagaaag
    1701  gcaaagggtc cttcttgagg cccgaaagca ggttccaggc gaggacggac
    1751  ggccaaccca actacccaat gtcattgatg agactttccc cttgacccgt
    1801  cccaactggg attttgctac gccggcaggt agggagcacc tacgccttta
    1851  tcgccagttg ctattagcgg gtctccgcgg ggctgcaaga cgccccacta
    1901  atttggcaca ggtaaagcag gttgtacaag ggaaagagga aacgccagca
    1951  gcatttttag aaagattaaa agaggcttac agaatgtaca ctccctatga
    2001  ccctgaggac ccagggcaag cagctagtgt tatactatcc tttatatacc
    2051  agtctagccc agatataaga aataagttac aaaggctaga aggtctacaa
    2101  gggttcaccc tatctgatct gctaaaagag gcagaaaaga tatacaacaa
    2151  aagggagacc ccagaggaaa gggaagaaag attatggcag cggcaagaag
    2201  aaagagataa aaagcgccac aaggagatga ctaaagttct ggccacagta
    2251  gttgctcaga atagagataa agatagagaa gaaagtaaac tgggggatca
    2301  aaggaaaata cctctgggaa aggaccagtg tgcctattgc aaggaaaagg
    2351  ggcattgggt tcgcgattgc cccaaacgac cccggaagaa acccgccaac
    2401  tccactctcc tcaacttagg agattaggag agtcagggcc aggacccccc
    2451  ccctgagccc aggataacct taaaaatagg ggggcaaccg gtgactttcc
    2501  tggtggacac gggagcccag cactcagtac taactcgacc agatggacct
    2551  ctcagtgacc gcacagccct ggtgcaagga gccacgggaa gcaaaaacta
    2601  ccggtggacc accgacagga gggtacaact ggcaaccggt aaggtgactc
    2651  attctttttt atatgtacct gaatgtccct acccgttatt agggagagac
    2701  ctattaacta aacttaaggc ccaaatccat tttaccggag aaggggctaa
    2751  tgttgttggg cccaagggtt tacccctaca agtccttact ttacaattag
    2801  aagaggagta tcggctattt gagcccgaaa gtacacaaaa acaggagatg
    2851  gacatttggc ttaaaaactt tccccaggcg tgggcagaaa caggaggtat
    2901  gggaacggct cattgtcaag cccccgttct cattcaactt aaggctactg
    2951  ccactccaat ctccatccga cagtatccta tgccccatga agcataccag
    3001  ggaattaagc ctcatataag aagaatgcta gatcaaggca tcctcaagcc
    3051  ctgccagtcc ccatggaata cacccttatt acctgttaag aagccaggga
    3101  ccgaggatta cagaccagtg caggacttaa gagaagtaaa caaaagagtg
    3151  gaagacatcc atcctactgt gccaaatcca tataacctcc ttagcaccct
    3201  cccgccgtct cacccttggt acactgtcct agatttaaaa gacgcttttt
    3251  tctgcctgcg actacactct gagagtcaat tactttttgc atttgaatgg
    3301  agagatccag aaataggact gtcagggcag ctaacctgga cacgccttcc
    3351  tcaagggttc aagaatagcc ccaccctatt tgatgaggcc ctgcactcag
    3401  acctggccga tttcagggta aggtacccgg ctctagtcct cctacaatat
    3451  gtagatgacc tcttgctggc tgcggcaacc aggactgaat gcctggaagg
    3501  gactaaggca ctccttgaga ctttgggcaa taaggggtac cgagcctctg
    3551  caaagaaggc ccaaatttgc ctgcaagaag tcacatacct ggggtactct
    3601  ttaaaagatg gccaaaggtg gcttaccaaa gctcgcaagg aagccatcct
    3651  atccatccct gtgcctaaaa actcacgaca agtaagagag ttccttggaa
    3701  ctgcaggtta ctgccggctg tggattcccg gttttgccga gctcgcagcc
    3751  ccgctatacc ctctcactcg accaggaact ctgttccagt ggggaacaga
    3801  gcaacaattg gccttcgagg acattaaaaa agccctcttg agttcccctg
    3851  ccctggggtt gccagatatc accaaaccct ttgaattatt tattgatgag
    3901  aactcaggat ttgcaaaggg ggtgttagtc caaaaactgg gaccctggaa
    3951  aagaccagtt gcctacctat caaaaaagct ggatacagtg gcatctggat
    4001  ggcccccttg tttacgcatg gttgcagcca tcgccatcct agtcaaggat
    4051  gcagggaagc taaccctagg acagccgcta actatcctga cctcccaccc
    4101  agttgaggca cttgtccgac agcctccaaa taaatggctc tctaatgcta
    4151  gaatgactca ttaccaagct atgctcctcg atgcagagcg agtccatttc
    4201  gggccgacag tctcccttaa ccctgctacc ttgctccccc tccccagcgg
    4251  gggaaaccac cacgactgtc tccagatttt agccgagacc catggcacca
    4301  gacccgactt aactgaccag ccgttgccgg atgcagacct gacctggtac
    4351  acagatggta gcagcttcat ccgtaatggc gagagagagg ccggagccgc
    4401  agtaacaacc gaatctgagg taatctgggc tgctcccctc ccacccggaa
    4451  cgtcagccca gcgagccgaa ctgattgccc tgacccaggc actaaagatg
    4501  gcagaaggta agaagctaac tgtctatacg gacagccgat atgcctttgc
    4551  tacaactcat gtacacgggg aaatctacag gcggcggggc ctactaactt
    4601  cagaaggaaa agaaattaaa aataaaaatg aaatcctcgc cctactagag
    4651  gcgttattct tacccaaaag actgagcatc atccattgcc cgggacacca
    4701  aaaaggtgat agtccccagg caaaaggaaa cagattagct gatgatacag
    4751  caaagaaagc cgccacagag actcattcat cactaaccgt cttacccact
    4801  gaacttatag agggtcccaa aaggcctcca tgggaatatg atgacagtga
    4851  tttagacctt gtgcaaaaac tcgaagctca ttatgagcca aagagaggta
    4901  cctgggagta ccgaggaaaa actatcatgc ctgaaaaata cgcaaaagag
    4951  ttgattagcc atctgcataa gttaacacac ctcagtgcta ggaaaatgaa
    5001  aactttacta gaaagagaag aaactgggtt ttacctccct aacagagact
    5051  tacacctccg gcaagtaaca gagagctgcc gggcatgtgc tcaaatcaac
    5101  gccggaaaga taaagtttgg acctgatgta agggcccgag gccgccggcc
    5151  cggaacacat tgggaagtag acttcactga aatcaagcca ggaatgtatg
    5201  gatataaata cctcttggtg ttcatagata ccttctctgg ctgggccgaa
    5251  gcttaccccg ccaaacatga aacagcaaaa gttgttgcca agaaactctt
    5301  agaagaaatt tttccccgct acgggatccc tcaggtattg ggttcagata
    5351  atggacccgc ctttatctcc caggtaagtc agtctgtggc caccctactg
    5401  gggattaatt ggaagttaca ttgtgcatac cgaccccaaa gttcaggtca
    5451  ggtagaaaga atgaatagat caattaagga gactttaact aaattaacgc
    5501  tagaaactgg ctctaaggat tgggtgctcc tcctgcccct ggttttatac
    5551  cgggtacgta acacgccagg cccccacggg ttaactcctt ttgaaatcct
    5601  gtacggggca cccccaccta tggctcactt ctttgatact gatatctcta
    5651  gcttcgctac ctcccccact atgcaggcac atttacgcgc cctgcagctg
    5701  gtccaagaag agatccagag acctctagcg gcggcctacc gagaaaaact
    5751  tgaaaccccg gttgtgcctc accccttcaa accaggagac tccgtctggg
    5801  ttcggagaca tcaaaccaag aacctcgagc cacggtggaa aggaccacat
    5851  atcgtcctcc tgaccacccc cacagcctta aaggtagacg gagttgctgc
    5901  ctggattcac gcctctcacg tgaaagctgc aggaccaacc accaatcaag
    5951  acctctcgga cagccccagc tcagacgatc catcaagatg gaaagtccaa
    6001  cgcacccaaa accctctaaa gataagactc tctcgtggaa cttagcgttt
    6051  ctggtgggga tcttattcac aatagacata ggaatggcca atcctagtcc
    6101  acaccaaata tataatgtaa cttgggtaat aaccaatatg caaactaaca
    6151  cccaagctaa tgccacctct atgttaggaa ccttaaccga tgcctaccct
    6201  accctacatg ttgacctatg tgacctagtg ggagacacct gggaacctat
    6251  agtcctagat ccaaccaatg taaaacacgg ggcacgttac tcctcctcaa
    6301  agtatggatg taaaactaca gatagaaaaa aacagcaaca aacatacccc
    6351  ttttacgtct gccccggaca tgccccctcg ctggggccaa agggaacaca
    6401  ttgtggaggg gcacaagatg ggttttgtgc cgcatgggga tgtgagacca
    6451  ccggagaagc ttggtggaag ccctcctcct catgggacta tatcacagta
    6501  aaaagaggga gtagtcagga caatagctgt gagggaaaat gcaaccccct
    6551  gattttgcag ttcacccaga agggaagaca agcctcttgg gacggaccta
    6601  agatatgggg attgcgacta taccgtacag gatatgaccc tatcgcctta
    6651  ttcacggtgt cccggcaggt gtcagccatt acgccgcctc aggcaatggg
    6701  accaaaccta gtcttacctg atcaaaaacc cccatccaga caatcccaaa
    6751  cagggtccaa agtggcgacc cagaggctcc aaacgactga aagcgcccca
    6801  aggtctgttg cccccaccac cgtgggtccc aaacggattg ggaccggaga
    6851  taggttaata aatttagtac aagggacata cctagcctta aatgccaccg
    6901  accccaacaa aactaaagac tgttggctct gcctggtttc tcgaccaccc
    6951  tattacgaag ggattgcaat cttaggtaac tacagcaacc aaacaaaccc
    7001  ccccccatcc tgcctatcta ctccgcaaca caaactgacc atatctgaag
    7051  tatcagggca aggactgtgc atagggactg ttcctaagac ccaccaggct
    7101  ttgtgcaatg agacacaaca gggacataca ggggcgcact atctagccgc
    7151  ccccaatggc gcctattggg cctgtaacac tggactcacc ccatgcattt
    7201  ccatggcggt gctcaattgg acctctgatt tttgtgtctt aatcgaatta
    7251  tggcccagag tgacttacca tcaacccgaa tatgtgtaca cacattttgc
    7301  caaagctgtc aggttccgaa gagaaccaat atcactaact gttgccctca
    7351  tgttgggagg actcactgta gggggcatag ccgcgggggt cggaacaggg
    7401  actaaagccc tccttgaaac agcccagttc agacaactac aaatggccat
    7451  gcacacagac atccaggccc tagaagagtc aattagtgcc ttagaaaagt
    7501  ccctgacctc cctttctgaa gtagtcttac aaaacagacg gggcctagat
    7551  attctattct tacaagaggg agggctctgt gccgcattaa aagaagaatg
    7601  ttgcttctat gcggatcaca ccggactcgt ccgagacaat atggctaaat
    7651  tgagagaaag actaaaacag cggcaacaac tgtttgactc ccaacaggga
    7701  tggtttgaag gatggttcaa caagtccccc tggttcacaa ccttaatttc
    7751  ctccattatg ggccccttac taatcctact cctaattctc ctcttcggcc
    7801  catgcatcct taacagatta gtacaattcg taaaagacag aatatctgtg
    7851  gtacaagcct taattttaac ccaacagtac caacagataa agcaatacga
    7901  tccggaccga ccatgatttc caattaaatg tatgattcca tttagtcccc
    7951  agaaaaaggg gggaatgaaa gaccccctac cccaaaattt agccagctac
    8001  tgcagtggtg ccatttcaca aggcatggaa aattactcaa gtatgttccc
    8051  atgagataca aggaagttag aggctaaaac aggatatctg tggttaagca
    8101  cctgggcccc ggcttgaggc caagaacagt taaaccccgg atatagctga
    8151  aacagcagaa gtttcaaggc cgctaccagc agtctccagg ctccccagtt
    8201  gaccagggtt cgaccttccg cctcatttaa actaaccaat ccccacgcct
    8251  ctcgcttctg tgcgcgcgct ttctgctata aaacgagcca tcagccccca
    8301  acgggcgcgc aagtctttgc tgagacttga ccgccccggg tacccgtgta
    8351  cgaataaacc tcttgctgat tgcatctgac tcgtggtctc ggtgttctgt
    8401  gggcgcgggg tctcatcgcc gaggaagacc tagttcaggg gtctttca