Sequence of DPV Norwalk virus

Norwalk virus, complete genome.

ACC No: AF093797

Dated: 2001-08-31 | Length: 7598 | CRC: -1648508082

                !!NA_SEQUENCE 1.0
ID   AF093797   standard; genomic RNA; VRL; 7598 BP.
XX
AC   AF093797;
XX
SV   AF093797.1
XX
DT   20-OCT-1998 (Rel. 57, Created)
DT   31-AUG-2001 (Rel. 69, Last updated, Version 4)
XX
DE   Norwalk virus, complete genome.
XX
KW   .
XX
OS   Norwalk virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae;
OC   Norovirus.
XX
RN   [1]
RP   1-7598
RX   MEDLINE; 20254531.
RX   PUBMED; 10795514.
RA   Schreier E., Doering F., Kuenkel U.;
RT   "Molecular epidemiology of outbreaks of gastroenteritis associated with
RT   small round structured viruses in Germany in 1997/98";
RL   Arch. Virol. 145(3):443-453(2000).
XX
RN   [2]
RP   1-7598
RA   Schreier E., Doering F., Kuenkel U.;
RT   ;
RL   Submitted (24-SEP-1998) to the EMBL/GenBank/DDBJ databases.
RL   Molecular Virology, Robert Koch Institute, Nordufer 20, Berlin 13353,
RL   Germany
XX
DR   GOA; Q9YS15.
DR   SPTREMBL; Q9YS13; Q9YS13.
DR   SPTREMBL; Q9YS14; Q9YS14.
DR   SPTREMBL; Q9YS15; Q9YS15.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .7598
FT                   /country="Germany"
FT                   /db_xref="taxon:11983"
FT                   /mol_type="genomic RNA"
FT                   /organism="Norwalk virus"
FT                   /strain="Norwalk-like"
FT                   /isolate="BS5"
FT   CDS             5. .5359
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9YS15"
FT                   /db_xref="SPTREMBL:Q9YS15"
FT                   /note="ORF1"
FT                   /product="polyprotein"
FT                   /protein_id="AAC64602.1"
FT                   /translation="MMMASKDVVATNASSTGDNSNTMKDRFLARLKSLGNTKPIKIENT
FT                   QMALGLLSREPSPSPNRDPPKQQRDRAPRSVAETQQAMGWTDPPVDQNLPTWEELSQSE
FT                   KQKIMAENSKWFDAGGLGPATLPSNYCRVQDNGDGDQQVKWSAKDGVNLGVDALTTVQG
FT                   PPWNLCPLPPVDQRNSGAAKEPLIGDMIEFYEGHIYHYAMYIGQGKTIGVHSPRAAFSI
FT                   PRITIHPIAAWWRVCYVPTQEQRLSYDQLKELENEPWPYAAVTNNCYEFCCRIMDLQDT
FT                   WLERRLVTSGRFNHPTQDWSKDTPDFQQDSKLEVVRDAVLAAINGLVSRPFKNLLNKLK
FT                   PLNILNLLSNCDWTFMGIVETIILLMELFGVFWDPPDVSNFIASLLPDMHLQGPEDLAK
FT                   DLIPLILGGIGLAIGFTKDKVTKVMKSAVDGLRAATQLGQYGLEVFAVIKKYFFGGDQT
FT                   EKTLKDIEAAVIDMEVISTTAITQLVRDKQSARTYMAILDAEEEKARKLSVKHADPHVV
FT                   STTNALISRISMARSALAKAQAELTNRVKPVVIMMCGPPGIGKTKAAEYLAKRLANEIR
FT                   PGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIADDCNKLQAIADTAPLTLNCDRIE
FT                   KKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYCSAPEVEQVRRVSPGDTGA
FT                   LKDCFKDDFSHLKMEIAPQGGFDNQGNTPFGKGTMRPTTINRLLIQAVALTMERQDEFQ
FT                   MQGPTYDFDSDRISAFTSLAKANGLSLIGMASLGKRLRSVNSIHGLKNALTGYTITPCT
FT                   IKWQARFYDIESDGNVVKICENTSAQTQRQQSIDTAVLALTRLRAARAAAYASCLQCAI
FT                   TTVLQMAGSALVIHRAVKRMFGTHTNAVSLEGPDREHRCRVHQAKANGRGPIGHDDVIE
FT                   KYGLCETEDEGTQEQEATIELPTASHEGKNKGKTKKGRGRKANYNAFSRRGLNDEEYEE
FT                   SRRLEKEKGGNYSIQEYLEDRQRYEEEMAEVQAGGDGGIGETEMEIRHRVFFKSKTKRN
FT                   RQEERRQLGLVTGSEIRKRKPIDWTPPKNEWADDDREVDYTEKINFEAPPTMWSRVTRF
FT                   GSGWGFWVSPTVFITTTHVIPIGAKEFFGEPLDSIAIHRAGEFTQFRFSRKIRPDLTGM
FT                   VLEEGCPEGVVCSILIKRDSGELLPLAVRMGAVASMKIQGRLVHGQSGMLLTGANAKGM
FT                   DLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNTVVCAVQAGEGETTLEGGDKGHYA
FT                   GHEIVRNSKGPALSSKTKFWRSTPEPLPPGVYEPAYLGGKDPRVKGGPSLYQVLRDQLK
FT                   PFAEPRGRMPEPGLLEAAVETVTSMLEQVMDTPTPWSYADACQSLDKTTSSGYPYHKRK
FT                   NDDWNGTTFVGELGEQAAHANNMYELGKSMKPLYTAALKDELVKPEKIYQKIKKRLLWG
FT                   ADLSTVIRSARAFGPFCDAIKSHVIKLPIKVGMNSIEDGPLIYAEHAKYKNHFDADYSA
FT                   WDSTQNRQIMMESFSIMCRLTASPDLAAVVARDLLAPSEMDVGDFVIRVKEGLPSGFPC
FT                   TSQVNSINHWLITLCALSEVTGLAPDVIQSQSYFSFYGDDEIVSTDIDFDPARLTQVLR
FT                   EYGLRPTRPDKSEGPIILRKNVDGLVFLRRTISKDAAGYQGRLDRNSIERQLWWTRGPN
FT                   HDDPNETLIPHPQRKIQLISLLGEASLHGEKFYRKISGRVIQEIKTGGLEMYVPGWQAM
FT                   FRWMRFHDLGLWTGDRDLLPEFVNDDGV"
FT   CDS             5343. .6965
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YS14"
FT                   /note="ORF2"
FT                   /product="capsid protein"
FT                   /protein_id="AAC64603.1"
FT                   /translation="MMMASKDAPPSPDGASGAGQLVPEVNTADQISMDPVAGASTAVAT
FT                   AGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNGWV
FT                   GNMRVRILLAGNAFTAGKVIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVELPLE
FT                   DVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSFLFLV
FT                   PPSVEQKTRVFSVPNIPLKDLSNSRVPTLIQGMFVSPDVNQSVQFQNGRCQIDGQLQGT
FT                   TPVSLSQLCKIRGRTSSNTRVLNLSEVDGTPFVPLESPAPVGFPDIGGCDWHVGFTFEA
FT                   RDQDPSQNVTFATNDSSFVPYLGSISPHNGDGFHSGDIIGSLDWISAPSDGSALDVWSI
FT                   PKYGSSLPDVTHLAPAVFPPGFGEVILYFHSKFPGSGPTDKLRVPCLIPQEFITHFCNE
FT                   QAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSISSGPQTLPINGVFVFVSWV
FT                   SRFYQLKPVGTASAARRLGLRRI"
FT   CDS             6965. .7594
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YS13"
FT                   /note="ORF3"
FT                   /product="unknown"
FT                   /protein_id="AAC64604.1"
FT                   /translation="MAQAIIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQNT
FT                   FQHDREMIGYQVQASNALLAKNLNTRYTLLQAGGLSSADAARAVAGAPVTRIVDWNGTR
FT                   VAAPTSSATTLKSGGFMPVPIPLTQKSKQPLMTGQDNPNYAASSISRTASWVQSQNSLR
FT                   SMPPFHNDALRTVWVTPPGSSSTSSMQSSFYGVFNTDRLPLFANRR"
XX
SQ   Sequence 7598 BP; 2025 A; 1822 C; 1888 G; 1863 T; 0 other;

AF093797  Length: 7598  January 8, 2004 16:02  Type: N  Check: 4613  ..

       1  gtgaatgatg atggcgtcga aagacgtcgt tgcaactaac gcttcaagca
      51  ctggtgacaa tagtaacaca atgaaggatc gctttttagc gagactcaaa
     101  agtttgggta acaccaagcc cataaaaatt gaaaacacac aaatggctct
     151  cgggcttcta agccgggagc catcaccatc gcccaaccgt gaccctccta
     201  aacaacaacg ggacagggca ccacggagtg tggctgaaac ccaacaggca
     251  atgggatgga cagacccacc cgttgatcaa aacctgccaa catgggagga
     301  gttgagccag tctgagaagc agaaaatcat ggctgagaat tcaaagtggt
     351  ttgatgctgg tggtctaggt cctgccacct tgccatcgaa ttattgtcgt
     401  gttcaagaca acggtgatgg tgaccagcag gttaaatgga gtgctaaaga
     451  tggtgtcaat ctgggggttg atgccctaac aactgtccaa ggccccccat
     501  ggaatttatg cccacttccc ccagtcgatc aacgcaatag tggggcagcc
     551  aaggaacccc tgattggaga tatgattgag ttctatgaag ggcacatata
     601  ccattatgcc atgtacatag gtcaggggaa aacaattggt gtgcattccc
     651  ctagggccgc tttctccata cctaggatta ccatacaccc aatcgctgcc
     701  tggtggaggg tatgctatgt ccccacccag gaacaaaggc tgagttatga
     751  ccaacttaaa gagcttgaaa atgaaccttg gccatatgca gctgttacta
     801  acaactgcta tgagttttgc tgcaggataa tggatctaca ggatacgtgg
     851  ttggagagga gattggtaac atcaggtcgc ttcaaccacc caactcagga
     901  ctggtccaag gacactccag acttccagca agatagtaag ttggaggttg
     951  tccgtgatgc cgtcttagca gcaattaatg gcctggtctc acgcccgttc
    1001  aagaacttgc taaataagct taaaccacta aatatcctca acctactgtc
    1051  caactgtgac tggaccttta tgggcatagt tgaaaccata atactgttga
    1101  tggaactctt tggggtcttt tgggaccccc ctgacgtgtc caacttcata
    1151  gcttctctcc tccctgacat gcaccttcaa ggcccggaag acttggccaa
    1201  agatctgata ccactcatac tgggtgggat tgggttggcc ataggtttca
    1251  ctaaggataa agtgacaaag gtgatgaaaa gtgcagttga tggtttgcgt
    1301  gcagctaccc aactggggca atatggcctg gaagtcttcg cagtcatcaa
    1351  gaagtatttc tttggaggtg atcagactga gaagacactt aaagacattg
    1401  aggcagcagt cattgatatg gaggttatct ccacgacagc cataacgcaa
    1451  ctagttagag acaagcaatc tgccaggact tatatggcca tactagatgc
    1501  tgaagaggaa aaggctagaa aactatctgt gaaacacgct gacccccacg
    1551  tggtgtcaac caccaacgca ttgatttcac gcatttcaat ggcacggtct
    1601  gccctggcta aggcacaagc tgagttgaca aacagggtta agccagtggt
    1651  gataatgatg tgtggccctc ctggtatagg caagacgaag gctgccgagt
    1701  acctagccaa acggcttgcc aatgaaatac gcccaggtgg gaaagttggt
    1751  ctagttccac gtgaagctgt cgaccactgg gacggttatc atggtgagga
    1801  ggttatgttg tgggatgact atggaatgtc aaagatagca gatgactgta
    1851  acaaactgca agcaatcgct gatacagccc ctttaacact caactgtgac
    1901  cgaatagaga agaaaggtat gcagttcgtg tcagatgcta ttgttataac
    1951  caccaacgcc cccgggccag cccctgttga ctttgtcaac ttaggacctg
    2001  tctgtcggcg tgttgacttc ctagtctatt gctccgcccc agaagtcgaa
    2051  caggtacggc gtgtcagccc tggagatact ggcgcgctca aagattgctt
    2101  caaagatgat ttctctcacc ttaagatgga aattgcacca cagggtggat
    2151  ttgacaacca agggaacaca ccatttggca agggcaccat gcgtcccacc
    2201  accataaaca ggcttttaat ccaggcagtc gccctcacca tggaacgcca
    2251  ggatgaattt caaatgcaag gaccaaccta tgattttgac tcagacagga
    2301  tttcagcttt cactagccta gccaaagcta atggcttaag cttgattggt
    2351  atggcaagcc tcggaaagag gctacgtagt gtcaactcaa tccatggcct
    2401  caaaaatgcc ctgactggtt acaccatcac accctgcacc ataaaatggc
    2451  aagctaggtt ttatgacata gagtctgatg gcaatgtggt caagatatgt
    2501  gagaacacaa gtgcacaaac ccaacgccaa cagtccattg acaccgctgt
    2551  cctcgcgctc acccggctca gggctgccag ggctgccgca tatgcatctt
    2601  gtctgcaatg tgccatcacg actgtgttgc agatggcggg ttcagctctt
    2651  gtcatacacc gagccgtcaa gcgtatgttc ggcacccaca ctaatgccgt
    2701  ctccttagag ggtcctgaca gggaacaccg ctgtcgagtg catcaggcta
    2751  aggctaatgg tcgtggcccc attggacatg atgatgttat agaaaagtat
    2801  gggctgtgtg aaacagaaga tgagggcacc caagagcaag aagccaccat
    2851  tgaattgccc actgcaagcc atgaaggcaa gaacaaaggg aaaaccaaaa
    2901  agggccgagg ccgaaaagcc aattacaatg ccttctctag acgtggtctc
    2951  aatgatgagg agtacgagga gtccagaaga ttagagaagg aaaaaggtgg
    3001  aaattacagc atccaagaat accttgaaga caggcagcgc tatgaggagg
    3051  agatggctga agtgcaggcc ggcggcgatg gtggaatagg tgagacagag
    3101  atggagatac gccatcgagt cttctttaag tccaagacaa agagaaaccg
    3151  tcaggaagaa cgtcggcagc ttggcttggt tacaggcagt gagataagga
    3201  agagaaaacc tatagattgg acccccccca aaaatgaatg ggcagatgac
    3251  gacagagagg tggactacac tgaaaaaata aactttgaag cccctcccac
    3301  catgtggagc cgagtcaccc gattcggctc cggatggggg ttctgggtca
    3351  gccctacagt gttcattact actacccatg ttataccaat tggggccaaa
    3401  gaattctttg gggaaccatt ggattccatt gccatacacc gtgcaggaga
    3451  gttcacacag ttccgtttct caaggaagat acggccagat ctaacaggga
    3501  tggttcttga ggaagggtgt cctgaagggg tggtttgctc gatcttgatc
    3551  aagcgtgatt caggtgagct gctaccattg gctgtgcgta tgggggctgt
    3601  ggcttcaatg aagatacagg gtcggttggt ccatggtcag tcgggtatgc
    3651  tcctgactgg tgccaatgca aaaggaatgg atctcggcac tctcccaggt
    3701  gattgtggtg caccctatgt ctacaagaga aacaatgatt gggttgtttg
    3751  cggtgtccac gcagcagcca ccaagtcagg caacactgtg gtctgtgcag
    3801  tgcaggcagg tgagggggag accactctag aaggaggtga caagggtcat
    3851  tatgctgggc acgaaatagt caggaacagt aagggccctg cactctcatc
    3901  taaaactaaa ttctggagat caacaccaga acccctaccc ccaggtgtct
    3951  atgaaccagc ttacctagga ggaaaagacc ctagagtcaa gggtggccct
    4001  tctttatatc aagtccttcg ggaccaactg aaaccttttg ctgagccacg
    4051  tgggcgcatg ccagagccag gtttactgga ggctgctgtt gagacagtga
    4101  cttctatgct ggaacaggtt atggacacgc ccacgccctg gtcatatgct
    4151  gatgcttgcc agtcattaga caagaccact agttctggat acccctacca
    4201  taagagaaag aatgatgatt ggaatggcac cacctttgtg ggagaacttg
    4251  gtgagcaagc agcccacgca aacaacatgt atgagctagg taagtccatg
    4301  aagcccctat atacagcagc cctcaaagat gaacttgtca aaccagagaa
    4351  gatctatcaa aaaattaaga aaaggttact ctggggggct gacctgtcaa
    4401  ccgtcatacg atctgcacgg gcttttggcc ccttctgtga cgccataaag
    4451  tcccatgtaa tcaagttgcc tattaaagtt ggtatgaatt caattgagga
    4501  tggcccccta atctatgctg aacatgcaaa atataagaat cactttgatg
    4551  cggattactc agcttgggac tcaacacaaa ataggcaaat tatgatggag
    4601  tctttctcaa tcatgtgccg cctcaccgcc tcaccagatt tggcggctgt
    4651  tgtggctaga gacctactag ccccttccga aatggatgtg ggagattttg
    4701  taataagggt taaggagggt ctcccatcag gcttcccctg tacttcacaa
    4751  gtcaatagca taaatcattg gctcattaca ttgtgtgcct tgtctgaggt
    4801  cacgggcttg gcacccgatg ttatacaatc acagtcatat ttctccttct
    4851  atggggacga tgagatcgtg tccacagaca ttgattttga cccggctcga
    4901  ctcacccagg tccttaggga gtatggactg cgtccaactc gcccagataa
    4951  aagtgagggc cccataatct tgaggaaaaa tgttgatggc ttggtattcc
    5001  ttaggcgcac tatctccaag gatgcagctg gttaccaggg ccgattggat
    5051  agaaactcca tagaaagaca gctatggtgg actcgtggcc ccaatcatga
    5101  tgacccaaat gagacgctca ttccccaccc ccaaagaaag atccaactta
    5151  tatcactgct gggagaggca tcacttcatg gggaaaagtt ttacaggaaa
    5201  atttcaggta gagtcatcca agagatcaag acaggtggac tggaaatgta
    5251  tgtgccaggc tggcaggcca tgttccgctg gatgcgtttt catgaccttg
    5301  gactttggac aggagatcgc gatctcctgc ccgaattcgt aaatgatgat
    5351  ggcgtctaag gacgccccac catcgcctga tggcgccagt ggcgctggcc
    5401  agctagtgcc ggaggttaat acagctgacc aaatttcaat ggatcctgtt
    5451  gcgggtgctt ctaccgcagt tgcaacagct gggcaagtta atatgattga
    5501  tccatggata ttcaacaatt ttgtccaggc cccccagggt gaatttacca
    5551  tttctccaaa taataccccc ggtgatattt tatttgattt acaattgggc
    5601  ccccacttga atcctttctt agctcattta tcacagatgt acaatggatg
    5651  ggttggcaat atgcgggtcc gcatattgct ggcaggcaat gccttcacag
    5701  ctggtaaggt aatcatatgt tgtgtccccc ctggctttga tgctagaata
    5751  cttactattg ctcaagctac cctatttcct cacttgattg ctgatgttag
    5801  gactcttgaa ccagtagaat tacctctcga ggatgtacgc aatgtcctct
    5851  accacaatag cagccagcca cagccaacca tgcgactggt ggctatgcta
    5901  tataccccat tgcgcacagg cggtgggtct ggaggcactg atgcttttgt
    5951  ggttgctggg agagttctga catgccccgc accagacttt agttttctgt
    6001  tccttgttcc tccctctgta gagcaaaaga ctagggtctt tagtgtcccc
    6051  aatataccac tcaaagatct ctcaaattcc cgagtgccaa ccttgatcca
    6101  gggcatgttt gtttctcctg atgtcaatca atcggtgcag ttccaaaatg
    6151  ggcgatgtca aattgatggt cagttgcaag gtaccacccc agtatccctc
    6201  agccaattat gtaagatcag aggtaggact tccagtaata ccagagtgct
    6251  taaccttagt gaggttgacg ggacaccttt tgtaccactt gagtcccctg
    6301  cacctgtagg ttttccagac ataggcgggt gtgattggca tgttggtttc
    6351  acttttgagg cacgagacca ggacccctct cagaatgtga cctttgcaac
    6401  caatgattct agctttgtac catatcttgg cagtatttca ccccacaatg
    6451  gtgatgggtt ccatagtggt gacatcatag gtagtttgga ttggatctca
    6501  gctccatcgg atggctccgc acttgatgta tggtctatac caaagtatgg
    6551  atcatctctt ccagatgtca cccatctggc ccctgcagtt tttccccctg
    6601  gctttggtga ggttatcctt tactttcact ctaaatttcc tggttctggc
    6651  cccactgata aacttagggt tccatgtttg ataccacaag agtttataac
    6701  acatttctgt aatgagcaag cacccatagc gggggaggct gccctccttc
    6751  actatgtgga ccctgacaca ggtaggaact taggggaatt caagctttat
    6801  ccagatggct ttatgacatg tgtgcctaac agcatcagca gtggtcccca
    6851  gactctgcca atcaatggtg tgtttgtatt tgtgtcctgg gtatccagat
    6901  tttaccaact taagcctgtg ggaacggcct cagcggccag gaggcttggt
    6951  cttcggcgca tataatggct caagccatca taggtgccat agcagcttct
    7001  gctgccggaa gcatactcgg tgctggcata caagctggtg ctgaggcagg
    7051  actccaagcc caacggtatc aacaggatct ccaactacaa cagaatactt
    7101  tccaacatga tagggaaatg atagggtacc aggtgcaggc cagtaatgcc
    7151  ctattggcta agaatctcaa cactagatac actctactgc aggcaggggg
    7201  tttgtctagt gcggatgcag ctagggctgt tgcaggcgct cctgttactc
    7251  gcatagtgga ttggaacgga acccgtgtgg cagcccccac atcgagcgcc
    7301  actactttaa aatctggtgg gttcatgcct gttcctatac ctttaaccca
    7351  gaaatctaaa caacctttaa tgactgggca agataatcct aactatgctg
    7401  cttcttctat ttctagaact gcttcatggg tgcaatccca aaactctttg
    7451  agatctatgc ccccttttca taatgatgct ctccggactg tgtgggtcac
    7501  gccacctggt tcgtcttcta catcttctat gcagtctagt ttctatggtg
    7551  tctttaatac agatagatta ccccttttcg caaataggag gtagggaa