Sequence of DPV Hirame rhabdovirus

Hirame rhabdovirus strain CA 9703, complete genome.

ACC No: AF104985

Dated: 2003-09-09 | Length: 11034 | CRC: 1454500001

                !!NA_SEQUENCE 1.0
ID   AF104985   standard; genomic RNA; VRL; 11034 BP.
XX
AC   AF104985;
XX
SV   AF104985.2
XX
DT   01-DEC-1999 (Rel. 61, Created)
DT   09-SEP-2003 (Rel. 77, Last updated, Version 2)
XX
DE   Hirame rhabdovirus strain CA 9703, complete genome.
XX
KW   .
XX
OS   Hirame rhabdovirus
OC   Viruses; ssRNA negative-strand viruses; Mononegavirales; Rhabdoviridae;
OC   Novirhabdovirus.
XX
RN   [1]
RP   1-11034
RA   Oh H.K., Choi T.J.;
RT   ;
RL   Submitted (05-NOV-1998) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, Pukyong National University, 599-1 Daeyeon-3 dong, Nam-Gu,
RL   Pusan 608-737, Korea
XX
RN   [2]
RC   Nucleotide and amino acid sequences updated by submitter
RP   1-11034
RA   Oh H.K., Eou J.-I., Kim D.-H., Choi T.-J.;
RT   ;
RL   Submitted (22-AUG-2002) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, Pukyong National University, 599-1 Daeyeon 3-Dong, Nam-gu,
RL   Busan 608-737, Korea
XX
DR   GOA; Q9QL89.
DR   SPTREMBL; Q9QL89; Q9QL89.
XX
CC   On Sep 8, 2003 this sequence version replaced gi:6492000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .11034
FT                   /db_xref="taxon:38142"
FT                   /mol_type="genomic RNA"
FT                   /organism="Hirame rhabdovirus"
FT                   /strain="CA 9703"
FT                   /isolation_source="rainbow trout gonad (RTG-2) cell line"
FT   misc_feature    1. .51
FT                   /note="3' untranslated region of viral genomic RNA; codes
FT                   for putative (+) leader RNA transcript; putative"
FT   misc_signal     52. .60
FT                   /note="signal sequence for transcriptional termination or
FT                   polyadenylation"
FT   gene            167. .1345
FT                   /gene="N"
FT   CDS             167. .1345
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9QL89"
FT                   /db_xref="SPTREMBL:Q9QL89"
FT                   /gene="N"
FT                   /product="nucleocapsid protein"
FT                   /protein_id="AAF14116.1"
FT                   /translation="MANLKEEFAGLRGVKGGALEDSGTEYDPTKINLTLYGTDKLYTLA
FT                   IIKRAVSQVGGSQTNKALGILCAFVTSENNPDMTDAAVKLLVDMRFKVDVVPVDDRLGD
FT                   NLDDPNSKLAEVLTEENMVDLVKGLLFTCALMVKYDVDKMATYCQQKLERLANSQGLNE
FT                   LTLISTSRAVLARIGAAVRPGQKLTKAIYGIILINLMDPATAARAKALCAMRLSGTGMT
FT                   MVGLFNQASKNLGAPPADLLEDLCMKSIIDSARRIVKLMRIVADVEDMTAKYAIMMSRM
FT                   LGDGYFKSYGINENSRITCILMNINEQYDEGTTGGLAGVRVSPPFRKLATEIARLLVKK
FT                   YDGNGSAGPGASDLVRQAEQAAQETEGEDDKYDEEGEEDGGEGEGGEDEEYY"
FT   misc_signal     1392. .1404
FT                   /note="signal sequence for transcriptional termination or
FT                   polyadenylation"
FT   gene            1445. .2128
FT                   /gene="M1"
FT   CDS             1445. .2128
FT                   /codon_start=1
FT                   /gene="M1"
FT                   /product="matrix protein 1"
FT                   /protein_id="AAQ73458.1"
FT                   /translation="MSDNEGEQFFDIPKNALDRVEARTMCPREDGKVVRKQAPLKEEPR
FT                   LEAEQKRSPKKQEKPRGMLPLEQLVLKYVVVVCSLDALREFGGLIAQIRQSHQADMTRH
FT                   LEAVATEHRANLQALTKSQQEHEKVSKEILSAVISIRSNLNENSSPRHKPLDLDQVNAE
FT                   RALGFGVGYRTALNVFGKLRGITPEEAGSQEVKNMAIREAEEDEYEGSRSFFKKVLDMV
FT                   KKTMR"
FT   gene            2234. .2815
FT                   /gene="M2"
FT   CDS             2234. .2815
FT                   /codon_start=1
FT                   /gene="M2"
FT                   /product="matrix protein 2"
FT                   /protein_id="AAQ73459.1"
FT                   /translation="MSLFKRTKKTILIPPPHLLSGDEDRVTVLNAEGEIKISGKRPTTL
FT                   DEKIYYSMSLAAAILGGNLHPSFQSLTYLFQQEMEFGSTIEKVNFGSRKPAPLTPIRWQ
FT                   KPEKCSFRPQPLDKKIPPQIYTVSVEGATITFSGRFLFSASHVGCDDNRVKLAGLDGFI
FT                   TSPNYQRVKDYYAQETVLALSFEIPTKKGK"
FT   gene            2924. .4450
FT                   /gene="G"
FT   CDS             2924. .4450
FT                   /codon_start=1
FT                   /gene="G"
FT                   /product="glycoprotein"
FT                   /protein_id="AAQ73460.1"
FT                   /translation="MDPRIMYYTVLLTTAARVYGQTIKPGVDSVSDQPTWANPLFTYPV
FT                   DCPAAKLSKVSPSQLRCPRIFDDENRGLVAYPAVIRSLSVGNNLGDIHTQGEYVHKVLY
FT                   RTTCSTGFFGGQTIEKALVEMKLAPREVGVYDTTTASALYFPAPRCQWYTDNVHNDLTF
FT                   YYTTAKSVLRDPYTLGFLDSDFIEGKCSKSPCQTHWSNVVWKGDSGVAACDTGSEIKGH
FT                   IFVDKTSHHVVKATSYGHHPWGLHRACMITFCGKPWIRTDLGDLIAIEYNGGATLLAFP
FT                   ACKDTTVGMRGSLDDFAYLDDLVKSSESREECLEAHAEIIATNSVTPYLLSKFRSPHPG
FT                   INDVYAMHDGSIYHGKCMTVAIDEVSKDRRTYRAHQTSAFVAWGHPFGDEWGGFHGLHG
FT                   NDTPVIPDLEKYVAQYKVSMMDKMDIRPVPHPSVQILYNDTDTADITIRKIDSFDLQSL
FT                   NWSFWPSLSALGGVPILLALVFFLYCCMNRRPSMPAAPQEIPMYHLASRG"
FT   gene            4528. .4863
FT                   /gene="NV"
FT   CDS             4528. .4863
FT                   /codon_start=1
FT                   /gene="NV"
FT                   /product="non-viral protein"
FT                   /protein_id="AAQ73461.1"
FT                   /translation="MNSKTPSTDIAALKDLLRYKVTVARHGFLFDDGKIVWSEDGDEAW
FT                   NRLLVVVGALRSSNRMSQALFMDMSITKGDGYLLFSDLQGTNNLQYRTPKFRQYLFPVD
FT                   EFLPLPR"
FT   gene            4947. .10907
FT                   /gene="L"
FT   CDS             4947. .10907
FT                   /codon_start=1
FT                   /gene="L"
FT                   /product="RNA polymerase"
FT                   /protein_id="AAQ73462.1"
FT                   /translation="MDFFDLDIEIKQERLPAECSLNSPLNISLSSQLTDRMTPQNENIR
FT                   RQRERIRTHTKTHSRIKHLSKLDNDSTRLHARLTEDLIKLQHLEVDSPVFDNWALLTSY
FT                   YAALDYTLPERASFDWGQAAPYWNLYTQLRTILLQSQKIRKKDRGVREIYSCGPLRLEF
FT                   VEGTVLYFTDKQSGGEFTKSGELPSITPYADFLAWVKIISQRAQAVLMAVILRVTDKGL
FT                   SPLPESLLSVYQTVDDILKRAGQPAIDLLKLWEPLVITKLGELLGDRFGLEEDFRLTIR
FT                   GEATRLAKKLAITNGLNRLMTVLDSQTEAQPLFQFFGLFKHFAYPRVFSRDTIQAIQEV
FT                   SDRPSSISAAEFLHDQCEIRKEFYIRYLKAYHRAPGLDLSALSPSSFLRESLEHGKIPN
FT                   EKSPHYSNKEWYFIKFTKSIEWPISDTLSTFLSDKAITRDRAAWIEEGHSGRDMSEKRL
FT                   LLKFIKENFSSVAEIVAAADAIYNNEGDRLIALKVKEMELKIKGRGFGLMTFMPRLLQV
FT                   LRESIAKKTSKLFPEITMTSSDLDMKKRKFMLSKRSDDRRGFIHINKSLDINKFCTSQR
FT                   QFNSSAVFSSLDEMMGTFPLFSRVHEIFEKTWIVDGSASDPPDLSHFTRILEECRLHGI
FT                   EAPHVWADGVFSGLKGGIEGLCQYVWTICLLLRVERVMQKTKLTHYILAQGDNVIITII
FT                   VPVEIHRDGIISDQESRRLLTLSRNIDLSLESELEKSGLTLKIEETLTSENISIYGKDL
FT                   HCPQHLTLALKKAASAAIISSEQYQDIPTFLSGLGTSLESLSECVNSKTGAHLFGVLMG
FT                   VAGWKDLATHQTWRGWRYPYHKAPLSGRVRASDMKIGKGEAVELTIPVMSPRQQGKETL
FT                   RELLANSLLGSALGMLAFPTPIDLEKRGVGDYITHRLAIARKALLSEKLDPHIEKRVRS
FT                   ACNLPLSSRVDLSKLFDSPFSLNLATEEDATAVIKRQAKKTLRLQEIGNDKLRAQIGNM
FT                   DKGIAALDADLAGAETINPRLNHMIRDITDEKESEMFVTKFASARTMRTLAMGDSSEVP
FT                   IVVLLEKKSQQKELYTIWRARRPHATMWKCSTVLAKGLRDISWGKTIVGVTSPSPIEAM
FT                   ETTHIDPTDWEDSRSRETLSINYYLSRAGIDEQTAKLTRGSLVPYYGTQTKPLIAKAYL
FT                   ELKGNPRTNKALLLLSVRESLVKTGSNLDELIMQLCSHALDIDAASLPALRAQEEATAG
FT                   EGLRGGIKESMSPVGPDNFYTNITHKVFNRKWVTPYHVNIADFIIQGLIETRKHLILNE
FT                   KMDGLLPLSSVKCTACFRKKEREFFDIPEGPTWKNDSTTSDPAYTYFTTWCDLPRVSTL
FT                   PTMDQQSATRLLGRGLSLNRPTAGEIITKFYSMSMESQRLLHPVDLLLGYGEGVVFGYI
FT                   RSQHIHHGALFQTKRETLTNKLRKFILDTKTQHAKQIGYLFQDEDSLHELMAQGLCPYV
FT                   PRSIPLTITELTNACAITTIRATEVILSAGSRVALMPVQAIDETDVDNSRLAANTMQTI
FT                   LGDSRPMNPVYLDCDLTTNMTAWESSIELDVLKSENFHIDGLLMDLTARELPISDTPWK
FT                   QRDWTCSNDPRIIAKGIKTKSLFIHQGVAEALNMTPDLLVVIGGGLGGCAVPYLQEWAD
FT                   VPLIFATLFDERERISEDGDLVVPPEILVRGMAPRMIERELLEAELCDVTNDGNRRLLT
FT                   RLVKKNRGKGTVVLIDEIENRGAPESLLQSSLQDLVRRLDKVCTLTSIHTVRESTVEQF
FT                   AQRTNSIKRDRKTVTLHWNRYNRRDQFEALVIVKGEETRSDYHVSTATAAQAFRKIDEQ
FT                   LEVEGRLSATRWSLPTLPAREKEILFGYVSSVFLKTNLVLSADDMDRETLLETIEDTAP
FT                   GLISWKEKLEHRDHAFRSDIDEKGITQDKVFNLICLAWVITGLRYGIWETDAQSIITKT
FT                   VYITRGPKLCPLGEKPKRVFASFKLQSDKRVEDAKGFLSALLHLEGFFPLGRQ"
XX
SQ   Sequence 11034 BP; 3128 A; 2938 C; 2702 G; 2266 T; 0 other;

AF104985  Length: 11034  December 5, 2003 15:01  Type: N  Check: 2138  ..

       1  gtatcaaaaa gataacatac gccaagacta ggagagatgg gggcagggga
      51  cagaaaaaaa tggcacttca gttgtacact gataacgtgt tatagacact
     101  agaaaccaag tctaagtgat atattctgtt tgcgatctct acaacaagat
     151  taaaccagaa atcaatatgg cgaaccttaa ggaagaattt gcaggactcc
     201  gaggagtgaa gggaggagcc ctcgaagact ctggcacgga gtatgatccc
     251  accaagatca acctgacgct ctacgggaca gacaagctct ataccctggc
     301  gatcatcaag agggcagtca gtcaggtcgg agggtcccaa accaacaaag
     351  cactaggaat cctttgtgct tttgtcacgt cagagaacaa ccctgacatg
     401  acagatgcag cagtcaagct cctggtggac atgaggttca aggtggacgt
     451  ggtgcccgtg gacgacaggc tcggtgacaa tctggatgac cccaactcaa
     501  agctggcgga ggtcctgacg gaagagaaca tggtggacct ggtgaaaggc
     551  cttctgttca cttgtgccct gatggtcaag tacgatgtgg acaagatggc
     601  cacatactgc cagcagaagc tggagcgact ggccaacagt cagggactca
     651  acgagctgac cctgataagc acgagtaggg cagttctggc tcggattggg
     701  gcagcggtaa gaccggggca gaagttaacc aaggccatct acgggatcat
     751  tcttatcaac ctgatggatc ccgccactgc tgccagggca aaggcccttt
     801  gtgccatgag gctgagcgga accggaatga ccatggtggg tctattcaat
     851  caggcctcta agaaccttgg agctccacct gcagatctgc tggaagatct
     901  ctgcatgaag tccatcatcg actctgccag gaggattgtc aagctgatga
     951  ggatcgttgc agacgtcgag gacatgaccg caaagtatgc catcatgatg
    1001  agcaggatgc ttggggatgg gtacttcaag tcctacggga tcaatgagaa
    1051  ctcacggatc acctgtatct tgatgaacat caacgagcag tacgatgagg
    1101  ggacaaccgg aggactggca ggagtcaggg tttcaccccc cttccgaaag
    1151  ctggcaaccg agattgctcg ccttctggtc aaaaagtatg acgggaacgg
    1201  atctgccggg ccaggtgcct cagatcttgt ccgccaggcc gagcaggcag
    1251  cgcaagagac cgagggcgag gatgataagt acgatgagga gggcgaggaa
    1301  gacggagggg agggagaggg gggagaggac gaagagtact actgagaccc
    1351  ggcatctatg tcgccttggg ttgcctccca acattactat tcttagatag
    1401  aaaaaaatgg cacgtttgtg taaaacaaca atcaacaaat cgcaatgtct
    1451  gataacgaag gagaacagtt ctttgatatt cccaagaatg ctctggacag
    1501  agttgaggca cggacgatgt gtcccaggga ggatggaaag gttgtccgga
    1551  aacaagcgcc tctaaaagag gaaccaagac tggaggcaga gcagaagcgg
    1601  tctccaaaga agcaggagaa accccgggga atgctccctc tggaacaact
    1651  tgttctgaag tatgtggttg tggtctgctc ccttgatgcg ctccgagagt
    1701  tcggaggact aattgcccag atcaggcagt ctcatcaggc cgatatgact
    1751  cgtcatctgg aggcagtggc aacagagcac cgggccaatc tccaggcgct
    1801  caccaagtct cagcaggagc acgagaaagt ctccaaagag atcctctcgg
    1851  cagtcatctc catccggtcc aacctcaacg agaactccag tccccgacac
    1901  aaacccctgg acctggacca ggtcaatgcg gagagagccc tcggatttgg
    1951  agtcgggtac cggaccgcct tgaacgtctt tggcaaacta cggggaatca
    2001  caccagaaga ggcaggctcg caagaagtca agaacatggc aatcagagag
    2051  gcagaagaag atgagtatga gggaagcaga agcttcttca agaaggtcct
    2101  cgatatggtc aagaagacca tgaggtagag caagccaaca tcccactcgc
    2151  caactcccac tcccctagat agaaaaaaat ggcacgttag tgtactgttt
    2201  taacagaaac caaaaccaaa gtcgaaagaa accatgtctc tcttcaagcg
    2251  aaccaagaag accattctga tccctccccc tcatctgctt agcggagacg
    2301  aggaccgggt gacagttcta aatgcagagg gcgagatcaa gatctcaggg
    2351  aagcgaccaa ccaccctcga tgagaagatc tactactcca tgagtctggc
    2401  cgccgccatt ctgggaggga atcttcatcc atctttccaa tctctgacct
    2451  atctatttca gcaggagatg gaattcggga gcaccataga aaaggtcaac
    2501  tttgggtccc ggaaaccggc ccccctgaca cctatcaggt ggcaaaagcc
    2551  cgagaagtgt tcattcaggc ctcaacccct ggacaaaaag atccctcctc
    2601  agatttacac tgtcagtgtg gagggggcga ccatcacctt ctccgggagg
    2651  tttctctttt cggccagtca tgtggggtgt gacgacaacc gggtcaagct
    2701  ggctggcctg gatggcttca tcacctcacc caactaccaa agagtgaaag
    2751  actattatgc acaggaaact gtcctggcgt tgtccttcga aattccaacc
    2801  aaaaaaggaa aatagtcaca atgactcccc atttaaatcg accctctcaa
    2851  atctatcaac tcacatcaga tagaaaaaaa tggcacattt gtgtgttttc
    2901  ataacaaaca atcgacactc gtcatggacc ctcgaataat gtattacact
    2951  gttctcctca cgacagctgc cagagtctat ggtcaaacca tcaagcctgg
    3001  agttgacagc gtatccgatc aacccacctg ggcgaatccc ctgtttacat
    3051  accctgtgga ctgtcctgcg gctaagctat ccaaggtgag tccctcacag
    3101  ttgaggtgcc cacgcatatt tgatgatgaa aaccgaggac tcgttgccta
    3151  ccctgctgtc atcagatccc tatcggtagg gaacaatctt ggggacattc
    3201  atactcaggg ggaatacgtc cacaaggtcc tttaccgaac cacatgttca
    3251  acagggttct ttgggggcca aaccatagag aaggccctag tagagatgaa
    3301  actggccccc agggaggtgg gagtgtatga caccacgaca gcctcagcac
    3351  tgtacttccc agctccaagg tgccaatggt acacggacaa tgtacataac
    3401  gacctgacat tctactatac gaccgccaag agtgtcctta gagatcctta
    3451  caccctggga ttccttgatt ctgattttat tgaagggaag tgctccaagt
    3501  cgccgtgtca gacccattgg tcaaatgtgg tgtggaaggg agactcggga
    3551  gttgccgcct gtgacacggg gtctgagata aagggtcaca tatttgtgga
    3601  caagacctcc caccatgtcg tcaaggcaac gagctatgga caccacccat
    3651  ggggacttca tcgagcttgc atgattacct tctgtggaaa accatggatc
    3701  aggacagacc taggggacct catcgcaatc gaatacaatg gcggggcgac
    3751  ccttctcgca ttccctgctt gcaaggacac cacggttgga atgagaggga
    3801  gtcttgacga ctttgcctac ttggatgatc tggtgaagtc atctgaaagt
    3851  cgggaggaat gtctagaggc acatgcggag atcatcgcta ccaatagtgt
    3901  gactccttac ctgctatcca aattcagatc tccccaccca ggaataaacg
    3951  atgtctacgc catgcatgac gggtccatat accacggaaa gtgcatgacc
    4001  gttgccattg atgaggtttc caaagataga cgaacttatc gtgcccacca
    4051  gacctcagct ttcgtagcat gggggcatcc cttcggtgat gaatggggcg
    4101  ggtttcacgg tcttcatggc aacgatactc ctgtgattcc ggatcttgag
    4151  aaatacgtcg ctcagtacaa ggtgagcatg atggacaaga tggacattcg
    4201  ccccgttccg catcctagtg tccagatact ctacaacgac acagacaccg
    4251  cagacatcac aatcaggaag atagactcgt ttgatctgca atcactcaac
    4301  tggagcttct ggccatcatt gtcagcactg ggaggggttc caatactcct
    4351  cgccctcgta ttctttctgt actgctgcat gaacagaaga ccctccatgc
    4401  ctgcagcacc ccaagagatc cccatgtacc acctcgccag tcgagggtaa
    4451  caccttccct cacttacctc tacaatccta gatagaaaaa aacggcacat
    4501  atgtctgtgg acctcccaca gccgaccatg aactcaaaaa ccccaagcac
    4551  cgacatcgca gcgttgaagg atctgctgag atacaaagtc acggtggcaa
    4601  gacatgggtt cttatttgat gatggaaaga ttgtttggag cgaagatggg
    4651  gatgaggcat ggaatagact ccttgttgtt gtcggggcat taaggtcctc
    4701  taacaggatg agtcaggcac tgttcatgga catgagcatc accaaggggg
    4751  acggatatct actcttctcc gacctgcagg gaacaaacaa tttgcagtac
    4801  cggaccccaa aattcaggca atacctgttt ccagtagacg agttcctccc
    4851  tctccccaga tagaaaaaaa tggcacttgt gtgcaaaaac aaaccaagcg
    4901  aaagacgcga ttaactggac cgagacagca acggatccac tacatcatgg
    4951  atttttttga tttagatata gagatcaagc aagagagact ccccgcggag
    5001  tgctctctca actctcccct caacatctct ctatcatctc aactgaccga
    5051  tcgtatgacc cctcaaaatg aaaacatccg gagacagaga gaaagaatca
    5101  gaacccacac aaagacacac tctcgtatca aacacctatc aaaacttgac
    5151  aatgactcaa ctagactcca tgcccgactt acagaagacc taatcaaact
    5201  acagcatctt gaagtcgatt caccagtctt cgacaattgg gcccttctga
    5251  catcttacta tgcagcccta gattacactc ttccagagag ggcgtcgttc
    5301  gactggggac aggccgcacc atactggaac ctctacaccc aactccggac
    5351  aatcctcctc cagagtcaaa agatcaggaa aaaagacaga ggggttaggg
    5401  aaatctactc gtgcggccca cttcgccttg aatttgtgga aggcacggta
    5451  ctgtacttca cagacaaaca atcagggggc gaatttacaa aatctggtga
    5501  attgcccagc atcacaccct atgcagactt cctcgcctgg gtaaaaatca
    5551  tttcccaacg agcacaagct gtcctgatgg cagtcattct cagagttaca
    5601  gataaaggac tctcaccact tccggagtca ctgctctctg tctaccagac
    5651  agttgatgac atcctgaaaa gagctggtca gccagccatt gacctgctga
    5701  aactctggga gcccttagta atcaccaagt tgggagaact cctcggggac
    5751  agatttgggc tcgaggagga ctttcgtctc acaatcagag gggaggccac
    5801  gagactggcc aaaaaactag ccatcaccaa cggactgaac cggttgatga
    5851  ccgtccttga ttcacaaaca gaagctcagc cgttgtttca gttctttgga
    5901  ctcttcaaac atttcgcgta cccccgagtg ttctcaagag acacgattca
    5951  ggccattcaa gaagtaagcg acagacccag ctcgatctca gcagctgaat
    6001  tccttcatga ccaatgcgag ataagaaagg aattctacat caggtatctc
    6051  aaggcatacc atcgagctcc gggcctggac ctgtcagccc ttagtccctc
    6101  gtcttttctg agagagagtc ttgagcatgg aaaaatccca aacgagaaga
    6151  gtccccatta ctcaaacaaa gagtggtact tcatcaaatt cacaaaaagc
    6201  attgaatggc ccatcagtga cactctgtca acatttttat ccgacaaagc
    6251  catcacaaga gatcgagcag catggatcga agaaggtcac tcaggtagag
    6301  acatgtcaga aaaacgtctt ctcctcaaat tcatcaaaga aaacttctct
    6351  agcgtggctg aaatcgtagc tgccgccgat gccatctaca acaacgaagg
    6401  agacagactg atcgcactca aggtgaaaga gatggagtta aaaataaagg
    6451  gacggggatt cgggctcatg actttcatgc cccggttact tcaggttctc
    6501  cgagagagta ttgcaaagaa aaccagcaag ctgtttccgg aaatcaccat
    6551  gacctcatct gacctggata tgaagaaaag aaaattcatg ctgtcaaaac
    6601  gaagcgatga ccgacgtggt ttcatccaca tcaacaagag tctggacata
    6651  aacaaattct gtaccagtca acggcaattc aactcaagtg ccgtgttctc
    6701  tagtctggat gaaatgatgg gaacatttcc tcttttttcc cgggtccacg
    6751  agattttcga aaaaacgtgg attgtggatg gttctgcatc tgatcccccg
    6801  gatttatccc atttcaccag gattttggaa gagtgccgtc tgcatggaat
    6851  tgaggcccct cacgtctggg cggacggagt attctctgga ctgaagggag
    6901  gaatcgaggg actctgtcaa tatgtgtgga ccatctgcct cctcctcagg
    6951  gtcgagcgag tcatgcagaa gaccaaactc acccactaca ttcttgcaca
    7001  gggagacaat gtcatcatca ccattatagt ccccgtggag atacatcgcg
    7051  atgggatcat ttcagaccaa gagtcccgtc gcctcctgac actgagccga
    7101  aacatagatc tatccctaga aagtgaactg gaaaagagcg ggctgaccct
    7151  aaagatcgag gagaccctaa cgagtgagaa catttcgatc tatgggaagg
    7201  atcttcattg tccccaacat ctgacgcttg cactcaagaa ggcagcctct
    7251  gcggcaatca tctccagtga acaatatcaa gacatcccca ccttcctgtc
    7301  tggccttggg accagcctgg agtccctctc cgaatgcgtg aatagcaaaa
    7351  caggggccca tctctttgga gtcttgatgg gggtagctgg atggaaggac
    7401  ctcgccaccc accagacctg gaggggatgg aggtatccct atcacaaggc
    7451  gccactctcg gggagggtcc gagcatctga tatgaaaatt ggaaagggtg
    7501  aagcggttga gctcacgatc ccagtcatgt ctccaagaca acaggggaaa
    7551  gagaccctaa gggaactcct cgccaacagt ctactgggat cagctctcgg
    7601  aatgctcgcc tttcccactc cgatcgacct agagaagcgt ggggtaggag
    7651  attacatcac acatcgtctg gcgattgcaa ggaaagccct cctgagcgag
    7701  aaactggacc cccatattga aaaacgagta aggtccgcct gcaaccttcc
    7751  cctctcttct cgggtggatc taagcaaatt attcgattcg cccttctcac
    7801  tcaatctagc caccgaagaa gacgcaaccg cggtcattaa gcgacaggca
    7851  aagaagaccc tccgactcca agagatcggg aacgacaagc tgagggccca
    7901  aattggcaac atggacaagg gaatagccgc cctggacgca gacctagccg
    7951  gggcagagac aatcaatccc cgcctgaacc acatgatcag ggacatcacg
    8001  gatgaaaaag aatcggagat gttcgtaacc aagtttgcgt cggcgagaac
    8051  tatgcggacc ctcgcaatgg gagactcatc cgaggtcccc atagtcgtgc
    8101  tccttgaaaa gaagagccaa caaaaagaac tgtacaccat ctggagagcc
    8151  agaagacccc acgccacgat gtggaaatgc tccacagtcc tggccaaggg
    8201  cctacgcgac atttcctggg ggaagaccat tgtgggagtg acctcaccgt
    8251  cccctatcga ggctatggaa accacacaca ttgatccgac agactgggag
    8301  gacagcaggt cgagggagac cctctccatt aactactatc tttcaagagc
    8351  ggggattgac gagcagaccg ccaagctcac tcgcggatct ctcgtcccct
    8401  actatggaac tcaaacaaag ccactcatcg caaaagccta cctggaactg
    8451  aagggcaacc ccagaacaaa caaggccctc ctcctgttaa gtgtccggga
    8501  gtccctggtc aagacaggaa gcaatcttga cgaactaatc atgcaacttt
    8551  gctcacatgc cctcgacatc gacgcagcgt ctcttcccgc actccgggca
    8601  caagaggaag cgacagcagg ggagggtctt cggggtggaa taaaagaatc
    8651  catgtcccct gtcgggcccg acaactttta caccaacatc acccataagg
    8701  tgttcaacag gaagtgggtc acaccatacc atgtcaacat tgccgacttc
    8751  atcattcagg gactcatcga gaccaggaaa cacctcatac tcaatgagaa
    8801  gatggacgga ctacttcccc tgagctcagt caagtgtacc gcctgttttc
    8851  ggaagaaaga gcgagaattc tttgacattc ccgagggacc gacatggaag
    8901  aatgactcaa cgacctccga tcctgcctac acctatttca caacatggtg
    8951  tgatctccca cgagtctcca ccctgcccac aatggatcag cagtcagcca
    9001  ctcgtctact gggaagggga ctgtctctaa acagaccaac cgcaggcgaa
    9051  atcatcacga agttctactc gatgtccatg gagtctcaga gactcctcca
    9101  tcccgtggac ctactccttg ggtacggaga aggagtggtg tttggataca
    9151  tcaggagtca acacatccac catggcgcac tctttcagac aaagagagag
    9201  acactcacaa acaaactgcg caaattcatc ttggacacga agacacaaca
    9251  tgccaaacag attggatatc tctttcaaga tgaagactcc ctgcatgagc
    9301  tgatggctca agggctctgc ccctatgttc cacgatcaat tccactaacc
    9351  atcaccgaac tgacgaatgc atgtgcgatc accaccattc gagccacaga
    9401  agtcatccta agtgcaggct ctcgagtcgc tctgatgcca gtccaggcaa
    9451  tcgacgagac cgacgttgac aacagccgtc ttgccgcgaa caccatgcag
    9501  acaattctag gagattccag gccaatgaat ccggtatacc tggactgcga
    9551  cctcaccacc aacatgaccg catgggagtc atccatcgag ctagacgttc
    9601  tcaagtcaga gaattttcac attgacggac tacttatgga cctcaccgca
    9651  agggaactcc cgatcagcga cacaccatgg aagcagaggg actggacatg
    9701  ctccaacgac cctcgaatca ttgcaaaagg gatcaagacc aagtcactgt
    9751  tcattcatca gggagtggca gaggcactga acatgacccc tgacctattg
    9801  gtcgtgattg gaggaggcct cggcggctgc gcggttccgt atctccagga
    9851  atgggcagat gtcccactga tattcgcaac tctgtttgac gagagagagc
    9901  gaatctcaga ggacggggac ttggtggttc ctccagaaat tctcgtcaga
    9951  gggatggccc ccaggatgat cgaaagagaa ctactggaag cggagctctg
   10001  cgatgtcacc aatgacggaa atagaagact cctcacacga ctggtcaaga
   10051  aaaatagggg aaagggaaca gtagtcctca tagacgagat agaaaacaga
   10101  ggggctcccg agtcactcct tcagagctcg ctgcaggatc tcgtccggag
   10151  actcgacaag gtctgcactc tgacctcgat acacactgtc cgggaatcca
   10201  ccgtggaaca atttgcccag agaaccaact ccatcaaaag agacaggaag
   10251  actgtgaccc tgcactggaa ccgctacaat cgaagggatc aatttgaggc
   10301  tcttgtcatt gtcaagggag aggaaacacg ttcagattat cacgtgtcca
   10351  ctgcgactgc agcacaggcc ttccgcaaga tcgacgaaca gctggaggta
   10401  gaaggacgac tctctgccac aagatggtcc ctcccaactc tcccagcccg
   10451  cgagaaggag atcctattcg gctatgtctc ctctgtcttt ttgaagacga
   10501  atctcgttct ctccgcagat gacatggacc gagaaacact gctagaaacc
   10551  atcgaggaca ctgcaccagg attgatctcc tggaaagaga aactcgagca
   10601  ccgagatcat gcctttcggt cagacatcga cgaaaagggg atcacacagg
   10651  acaaagtctt caacctcatc tgtctagcct gggtcataac cggactacgc
   10701  tacggaatat gggaaaccga cgcgcaatcc atcatcacca agacggtcta
   10751  catcacccga ggccccaagc tctgccctct tggagaaaaa ccaaaacggg
   10801  tcttcgcatc cttcaaactt caaagtgata agagggtaga ggacgcaaaa
   10851  ggatttctta gcgcgctgct acacctagag ggcttctttc ctcttggtag
   10901  gcagtagccg gtctgtcccc tcccgcagcg cccagggacc cagcacccag
   10951  atacaaaaaa acgagaccag tgttcccgtt cgggaaccca aaaatcacca
   11001  ccccttcaga acctctctgt tacctttttt atac