Sequence of DPV Trichomonas vaginalis virus 2

Trichomonas vaginalis virus II capsid protein (cap) gene, complete cds; and RNA-dependent RNA polymerase (pol) gene, partial cds.

ACC No: AF127178

Dated: 2001-05-31 | Length: 4674 | CRC: -1448973361

                !!NA_SEQUENCE 1.0
ID   AF127178   standard; RNA; VRL; 4674 BP.
XX
AC   AF127178;
XX
SV   AF127178.1
XX
DT   02-FEB-2000 (Rel. 62, Created)
DT   31-MAY-2001 (Rel. 67, Last updated, Version 2)
XX
DE   Trichomonas vaginalis virus II capsid protein (cap) gene, complete cds; and
DE   RNA-dependent RNA polymerase (pol) gene, partial cds.
XX
KW   .
XX
OS   Trichomonas vaginalis virus II
OC   Viruses; dsRNA viruses; Totiviridae; Giardiavirus.
XX
RN   [1]
RP   1-4674
RX   MEDLINE; 20130749.
RX   PUBMED; 10662630.
RA   Bessarab I.N., Liu H.W., Ip C.F., Tai J.H.;
RT   "The complete cDNA sequence of a type II Trichomonas vaginalis virus";
RL   Virology 267(2):350-359(2000).
XX
RN   [2]
RP   1-4674
RA   Bessarab I.N., Tai J.-H.;
RT   ;
RL   Submitted (10-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Division of Infectious Diseases, Institute of Biomedical Sciences, Academia
RL   Sinica, Taipei 11529, Taiwan, R.O.C.
XX
DR   SPTREMBL; Q9JE94; Q9JE94.
DR   SPTREMBL; Q9JE95; Q9JE95.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4674
FT                   /db_xref="taxon:107571"
FT                   /organism="Trichomonas vaginalis virus II"
FT                   /specific_host="Trichomonas vaginali T1"
FT   CDS             296. .2425
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9JE95"
FT                   /gene="cap"
FT                   /product="capsid protein"
FT                   /protein_id="AAF29444.1"
FT                   /translation="MASTLISSDNSATLGKDSEVINNTNTSPPDNPSSDHSNPRLTKVL
FT                   DEMSKKPCVNINEIRKMIRNFQPQFIQPRNGNRPNAQPRTVDSFEWVVRIQSTVETQLL
FT                   GATNTVPQQTLNLDISFTDDSTTITPASIPGSISMLDNSRHIPAIQSMIQNFKARYLGS
FT                   LQDTAQLQSPQYPQLLAYLFGQLIAIKDRLDLFRPSNPLSLADALFGFTLAQNARPRYD
FT                   DHRHAKACQGPLVIPAATNSDCGPCGFVQINANQGLTLPLGACLFVNPETVNDQSFQDF
FT                   LWLIFATHHRMPNQMQNNWPFSLNIVSTCAAPGRQAPHAGELTDERVRLALDTGHRILL
FT                   SMFNDDEETLRYYQRKGIETMFRPCCFYTEGGLLRKATRYVSMVPLNGLYYYNGATSYV
FT                   VSPIHTDAHPGITAAIESFVDIMVLQAVFSFSGPKVVAAKVNASQIDAAMVFGPAVAEG
FT                   DGFVYDPLRPAPPLSAFYTEFIHRPAEQRIFQMAMSQIYGSHAPLIIANVINSIHNCKT
FT                   KIVNNKLRATFVRRPPGAPHLKADTAIINRFHDPELAYALGILADGIAPLDGSHEYNVL
FT                   DELDYLFNGGDIRNCFGLNALNTRGLGQIVHIRPKREPGKRPRRGFYTTLDGQVHPVTQ
FT                   DAPLDEIYHWRDHGNLTRPYSCHILDSQGLEFADVSNGRSRGKILVVVNSPLKTCAAYQ
FT                   GPSFAPKPGSAMWNE"
FT   CDS             <2302. .4605
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9JE94"
FT                   /note="translated via ribosomal frameshift"
FT                   /gene="pol"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAF29445.1"
FT                   /translation="RFQRTVTRKDPCGRQLTPQDMRCLPGPQLRAKAGQRHVERINQCG
FT                   GSVIYPRLSTARACSLSAIDKMTLALAHQLCYLYKSSDLHRQLDTMIPQSYLTFLEWLL
FT                   RIDPHNEKSSIRHFPSQDNHEVITHSLRNLTKEQEITLFPIKDIVQANRRVNAYARNLL
FT                   DASPLPDFALQQMLLPNTANDVVCAILLLGEVLWMLRCPISIIVNISRAICRNDSFLKD
FT                   LSDFNKMLGLTKIPIANCLTELNTLQGRGVTSSDAKRDLTHRIADVNPHEAKISRENLR
FT                   EAINQIYKEEITRKEVPDTFKQHVFTSPLWVKKGAHHHPLFGSYDNRLEFVENVDLDRV
FT                   LKSHPAVYITQAPKLEHGKTRFIYNCDTVSYIYFDYILNYIESVWSNKHVLLNPDYMNP
FT                   VIFSTLNYDEYCMLDYTDFNSQHSIESMKQVFLCLFPFLPRSMHSILQWCVTSFDNMYI
FT                   NKTHWNSTLPSGHRATTFINSVLNRAYLLPFLQVANAFHTGDDVLLCGKADYATLINTV
FT                   PYELNKTKQSFGPSAEFLRLHKHNDQVSGYPARAISSLVSGNWLSFANPLWQPSLLSIM
FT                   QQLYTISARSGLLPYIPVTMKLEVQRRYDLRSRITNGLFSGDIVPSGCPCYKSNAALLS
FT                   AVVPDTVVKAPPTFYDLRTLDILKQTSPWINSASRYMDLLERRHMESDNKNVIYSIQYL
FT                   PSKMLPMIDVDPADATPLRKRYHPRSHIAHPLPRDAHLKELRFATCRVGPATAIRLGSL
FT                   WPANRINLIKPVYV"
XX
SQ   Sequence 4674 BP; 1310 A; 1253 C; 883 G; 1226 T; 2 other;

AF127178  Length: 4674  December 21, 2001 14:52  Type: N  Check: 8794  ..

       1  ctttgaagga gtgacgacct ttaaagccca ggcctaatca gcctggtcag
      51  acactcctgg ggtccatcag gagacggatc gctaacgcga actggatgtc
     101  agtgtcaaaa gccttgtgcg ccatggatac ttggtacact tttacgggag
     151  taggtgcccc gcgaactctg gacagtttat tgggatttaa aactgtactc
     201  tgaattgcta gccttatgca attgacgtgt attgagaggg cttatttgtg
     251  gctttcatac tagtattgtg tgatygtcta catttaatta cgataatggc
     301  ttcgacgcta atatcgtctg ataattctgc cacgttaggc aaagatagtg
     351  aagttatcaa caacacaaat acttcaccac ccgacaatcc atctagtgac
     401  cactcaaatc cccggttaac aaaggttcta gatgagatgt ccaaaaaacc
     451  atgtgttaat ataaacgaaa taagaaaaat gattagaaat tttcaacctc
     501  aatttattca acctcgcaac ggaaaccgtc caaatgccca gcctcgcaca
     551  gtagattctt tcgaatgggt cgttcgtatc caaagcaccg tcgagactca
     601  attacttggt gctacaaata ctgttcctca acaaactctt aatcttgata
     651  tttcttttac tgatgattct actactatta ctccagcttc aattccaggc
     701  tcgatctcaa tgctcgataa ttctcgtcac atcccagcaa tccaaagtat
     751  gatccagaac ttcaaggctc gttatttagg ctctttacaa gacactgccc
     801  agctccagtc cccacagtat ccacaacttc tcgcttactt attcggccag
     851  ctaatcgcga ttaaggatcg cctcgatctc ttcaggccat caaatccact
     901  ttctctcgct gacgctttgt tcggcttcac tttagctcaa aacgctcgcc
     951  cacgttacga cgaccacaga cacgctaaag catgccaagg acccctcgtt
    1001  attccagcag ctactaatag tgactgcggt ccctgcggct tcgtacagat
    1051  caacgcaaat caaggcctca ctctccctct tggcgcttgt cttttcgtca
    1101  atccagaaac agttaatgat caatctttcc aagatttcct ctggctcatc
    1151  ttcgcaacac accaccgcat gccaaatcaa atgcagaaca attggccgtt
    1201  ttctctcaac atcgtttcaa catgtgcggc tcctggtcgt caagcccctc
    1251  acgccggtga actcactgat gagagggtca gactcgccct tgatacaggc
    1301  caccgcattt tgctttctat gttcaatgat gatgaagaaa ctctccgtta
    1351  ttatcaacgc aaaggaatcg aaacaatgtt cagaccatgc tgcttctaca
    1401  ctgagggcgg cttactcaga aaggctacca gatacgtttc aatggtccca
    1451  ctcaacggcc tatattatta caatggtgcg acctcatacg ttgtctcccc
    1501  aatccatacc gatgcgcatc ctggaattac agcagctatc gaatccttcg
    1551  tcgacattat ggtcttacaa gcagtcttct ccttttccgg tcccaaagtt
    1601  gtcgctgcta aagtcaatgc cagccaaatc gatgcagcta tggtcttcgg
    1651  ccccgctgtc gctgaaggag acggcttcgt ctacgaccca ctccgtccag
    1701  cacctccact ttccgcgttc tacaccgaat tcatccacag accagccgaa
    1751  caacgcatct tccagatggc gatgagccaa atctacggat cacatgctcc
    1801  tctcatcatt gccaacgtca tcaactccat tcacaactgc aagacaaaga
    1851  tcgttaacaa caaattacgc gccactttcg ttcgtcgccc acccggcgcc
    1901  cctcatctca aggccgatac tgctatcatc aaccgcttcc acgatccaga
    1951  actcgcctac gctctcggaa tcctcgccga tggcattgct cctctcgatg
    2001  gctcgcacga gtacaatgtc cttgatgaac tcgactactt attcaatggt
    2051  ggcgacattc gcaattgctt cggcctcaac gccctcaaca cccgtggttt
    2101  gggccaaatc gttcacatcc ggccaaaacg cgagccggga aaaagacctc
    2151  gccgcggttt ctacaccaca ctcgatggac aggttcaccc ygttacacaa
    2201  gatgctccac tcgatgagat ttaccattgg cgcgaccatg gaaatctcac
    2251  acgtccatat tcgtgccaca tcctcgacag tcaaggactc gagtttgctg
    2301  acgtttccaa cggacggtca cgcggaaaga tccttgtggt cgtcaactca
    2351  cccctcaaga catgcgctgc ctaccagggc cccagcttcg cgccaaagcc
    2401  gggcagcgcc atgtggaacg aataaaccaa tgcgggggca gcgtcatcta
    2451  tccgcgcttg agcactgctc gcgcctgcag cttgtctgcc attgataaga
    2501  tgacgttggc cctcgcacac caactgtgct acctatataa gtcttcagac
    2551  ttacaccgac agttggacac catgatacca caatcctact taacatttct
    2601  tgaatggcta ctcagaatcg accctcacaa tgaaaaaagc tcaattcgtc
    2651  acttcccaag tcaagacaat catgaagtca ttacacacag tctaagaaac
    2701  cttactaaag aacaagaaat cacactgttt ccaatcaaag acatagtcca
    2751  agctaaccgt cgcgtgaatg cttacgcgcg aaatcttctc gatgcttcac
    2801  cgcttccaga ttttgcccta caacagatgc tcttaccaaa tacagcaaat
    2851  gatgtagtct gtgcaatctt actactcggt gaagtattgt ggatgcttcg
    2901  ctgcccaatc tcaatcatcg tgaacatttc acgtgcaata tgtcgcaatg
    2951  atagtttttt gaaggattta tctgacttca ataagatgtt aggcttaacc
    3001  aagataccta tagctaactg cttaacagaa ttgaatactt tacaaggtcg
    3051  tggagtaact tcaagcgatg ccaaaagaga cttgacccac cgaattgccg
    3101  atgtcaatcc tcatgaggcg aaaataagta gagagaatct cagagaagca
    3151  atcaatcaaa tatacaagga agaaattact aggaaggaag ttcctgatac
    3201  gttcaaacaa catgtattca catctccttt atgggttaag aaaggtgcac
    3251  accatcatcc actatttggg tcttatgaca atcggctgga gtttgttgag
    3301  aatgtagact tagacagggt cttaaaatca caccctgctg tctatatcac
    3351  gcaagcgccg aaacttgaac atggtaagac tcgattcatt tacaattgcg
    3401  atacagtcag ttacatttac tttgattaca ttttgaatta tatcgagagt
    3451  gtctggtcta ataaacatgt gctcctgaat cctgattaca tgaacccagt
    3501  catcttcagt actcttaact atgacgaata ctgcatgtta gattacactg
    3551  acttcaactc acagcactcc atcgaaagca tgaaacaggt gtttttatgt
    3601  ctttttccct tcctgccaag gtctatgcac tctattttac aatggtgcgt
    3651  cacgtctttc gacaatatgt atatcaacaa gactcattgg aattccacac
    3701  taccgtcagg acatagagcg acaacattta ttaattctgt cctgaacagg
    3751  gcttatttac ttccatttct acaagtcgct aacgcgttcc atacaggcga
    3801  cgatgtactg ttatgcggaa aggcagacta cgccacactt atcaacactg
    3851  taccttacga actcaacaag actaagcaat cattcggacc ctcggctgaa
    3901  tttctgcgac ttcacaaaca caacgaccaa gtctctggtt acccggcacg
    3951  tgcaattagc agtctcgtaa gcggcaactg gttgtcattc gccaacccac
    4001  tatggcaacc ttcgctactg tcaattatgc aacaattgta cacgatatcg
    4051  gcaaggtcag gtctgttacc atatattcct gtaacaatga agttagaagt
    4101  ccagcggcgt tatgatttgc gttcacgaat taccaacgga ttgttctctg
    4151  gtgatatagt tccaagcggt tgcccttgtt ataagtcaaa tgcggcttta
    4201  ctaagcgcag tagttcctga cactgtagta aaggctcccc ccacctttta
    4251  tgacttacgt acattggata tcctaaagca aacatcacct tggatcaatt
    4301  cagcgtccag atatatggac ctcctggaac gacgacatat ggaatctgac
    4351  aataaaaatg ttatatatag tatccaatac ctaccatcta agatgctacc
    4401  aatgattgat gttgaccctg cagacgctac cccattacga aaacggtatc
    4451  acccacgttc tcacatcgca cacccactcc cacgagatgc tcatcttaag
    4501  gaattaagat ttgcaacgtg cagagtgggc ccggctactg cgataagatt
    4551  aggatcgctt tggcctgcga atagaatcaa cctaatcaag ccagtctacg
    4601  tttaagtaag actgacaaaa tcttacataa ctactcggtt agagtaggag
    4651  agtaatatca actcttacgt caac