Sequence of DPV Snakehead virus

Snakehead rhabdovirus complete genome.

ACC No: AF147498

Dated: 1999-09-29 | Length: 11550 | CRC: 1009745146

                !!NA_SEQUENCE 1.0
ID   AF147498   standard; RNA; VRL; 11550 BP.
XX
AC   AF147498;
XX
SV   AF147498.1
XX
DT   29-SEP-1999 (Rel. 61, Created)
DT   29-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Snakehead rhabdovirus complete genome.
XX
KW   .
XX
OS   snakehead rhabdovirus
OC   Viruses; ssRNA negative-strand viruses; Mononegavirales; Rhabdoviridae;
OC   unclassified Rhabdoviridae.
XX
RN   [1]
RP   1-11550
RA   Johnson M.C., Bell R.H., Leong J.C.;
RT   "The Complete Genomic Sequence of Snakehead Rhabdovirus";
RL   Unpublished.
XX
RN   [2]
RP   1-11550
RA   Johnson M.C., Bell R.H., Leong J.C.;
RT   ;
RL   Submitted (02-MAY-1999) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, Oregon State University, Nash Hall Rm. 220, Corvallis, OR
RL   97331, USA
XX
DR   SPTREMBL; Q9QJT4; Q9QJT4.
DR   SPTREMBL; Q9QJT5; Q9QJT5.
DR   SPTREMBL; Q9QJT6; Q9QJT6.
DR   SPTREMBL; Q9QJT7; Q9QJT7.
DR   SPTREMBL; Q9QJT8; Q9QJT8.
DR   SPTREMBL; Q9QJT9; Q9QJT9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .11550
FT                   /db_xref="taxon:103603"
FT                   /note="SHRV"
FT                   /organism="snakehead rhabdovirus"
FT                   /specific_host="Ophicephalus struatus"
FT   misc_feature    1. .55
FT                   /note="leader region"
FT   mRNA            56. .1516
FT                   /gene="N"
FT                   /product="nucleocapsid protein"
FT   CDS             174. .1373
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT9"
FT                   /gene="N"
FT                   /product="nucleocapsid protein"
FT                   /protein_id="AAD56766.1"
FT                   /translation="MAFQKEFFGLRDVKVDLSAGEGLDFDPSEVELTVYRTGADTDGNT
FT                   IIKALAAVGGPKTNEALSVLLAFVTLGTDQDEYETRIKILKEIGFSVKEVPMAKDASSG
FT                   IEAPLENVAALVKPETVYQVIRGVLYTCALFVKYNVEKMQKYIKNKLPALATSYGVPEL
FT                   EEFPTESSALKKLASCIRPGQRITNALYAFLLVEMARPETQQGARALAAMRINGTGMTM
FT                   VGLFTQAAKNLGATPSDLLEDLCMRSLVDSARRIVRLMVQVSQAETIQARYAVMMSRML
FT                   NENYFKAYGLNDNSRISAILVAVNGHFSEDTIEALEGIKVSAEFADLARRIAIALIEKY
FT                   DNASDGGEGASEIIKSAVRGSSGAFKGSRGKPQGRRQEASGEGDLDSEDDDDQDYSKYA
FT                   "
FT   misc_feature    1504. .1522
FT                   /note="putative polyadenylation/transcriptional start
FT                   sequence"
FT   mRNA            1519. .2297
FT                   /gene="P"
FT                   /product="polymerase-associated protein"
FT   CDS             1588. .2250
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT8"
FT                   /note="phosphoprotein"
FT                   /gene="P"
FT                   /product="polymerase-associated protein"
FT                   /protein_id="AAD56767.1"
FT                   /translation="MAESIEMGEELVSSPSTLLALKGKLENPSPDDATILGILGKKTPT
FT                   VKMEKGKGKGDPIEAFLLEFVDERRQVEANKRLRQYIRQLKMSHQEELTAHLERASAEN
FT                   RANLKSMMESQAESNKTTKTILATLITLRDHVIEEGSKKPRGLDKDQIKLERALGFERG
FT                   YSSAIAIVNQLKVTEPSQVCKPSVRAAALSAMEKGEFESSGEVFKAVVKRAKAELTK"
FT   misc_feature    2285. .2303
FT                   /note="putative polyadenylation/transcriptional start
FT                   sequence"
FT   mRNA            2300. .3157
FT                   /gene="M"
FT                   /product="matrix protein"
FT   CDS             2365. .2934
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT7"
FT                   /gene="M"
FT                   /product="matrix protein"
FT                   /protein_id="AAD56768.1"
FT                   /translation="MPFIRRPKRAILIPPLHLTLKDDDKVLVVETVGTLIISGMTPSNL
FT                   TEKLGLAMKLASAILGGDSHPAFNPLVEIFSGAMEFGASVEKLDFMTRENKVITTYKVA
FT                   RGKAVALSNFPMEKRVGEKSYTTQIRNGSITYTGSFLFSAEHVGLKDNRSLFAAGEGLR
FT                   ESPDMAQAREAFAGSLPKGKNESSRK"
FT   misc_feature    3145. .3163
FT                   /note="putative polyadenylation/transcriptional start
FT                   sequence"
FT   mRNA            3160. .4828
FT                   /gene="G"
FT                   /product="transmembrane envelope protein"
FT   CDS             3203. .4741
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT6"
FT                   /note="glycoprotein"
FT                   /gene="G"
FT                   /product="transmembrane envelope protein"
FT                   /protein_id="AAD56769.1"
FT                   /translation="MTLPNMKPKRIVLFLVFLNAWVSNAQVTHKPRPDSIVEYSEEWEN
FT                   PIYTTPSHCFEDTFAPVKPEKLRCPHIFDDQNLGLTASKAKILHMDLKPEDTHFEAKGR
FT                   LLHKVTYQVLCSTGFFGGRTVTRKVLETPMGDNEAQAYKAVDREFPYFPEPLCFWLRDN
FT                   VAAERVFHFSTPKTVTVDLYSRKYISPDFVGGQCAKSPCPTHWPNVYWVGETQSPECPS
FT                   IDTEGGHIFTKKDTHRITKAVVHGHHPWGLTKACQIQFCNEQWIRTDLGDLIRIEPNDG
FT                   TSSLTLPKCQDNVVQMRGNLDDFSYLNHAIVNMAQRSECLEAHSSIVAQQKVSPYLLSK
FT                   FRPPHPGLGKAHYLQNNTIMRGDCIYEGVAEISENRTTYRNLKGEWKKWSLSRGGEGYD
FT                   GMTVGTKIVIPDLEKYQSIYDNGMFIPKLLGEVPHPSIVITYNQTDSIETGIFTDGKLL
FT                   NMGVNWTLWPSLSGISLFTVASLILIWYCCCRVTPQALNYSIPMHTITSRGVEI"
FT   misc_feature    4815. .4834
FT                   /note="putative polyadenylation/transcriptional start
FT                   sequence"
FT   mRNA            4831. .5305
FT                   /gene="NV"
FT                   /product="non-virion protein"
FT   CDS             4897. .5265
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT5"
FT                   /gene="NV"
FT                   /function="unknown"
FT                   /product="non-virion protein"
FT                   /protein_id="AAD56770.1"
FT                   /translation="MPGNNHNDRPVALIMSRLSRDPRDCIHHTVDTRGMTPGKIIHQVI
FT                   PPHPTQMRHTNRPSPPVILNLQILSEGGHVCARDVDTADPVPRAGPERTIQWGTDRDAT
FT                   EELASPAPEEIYEDNDSW"
FT   misc_feature    5293. .5450
FT                   /note="putative polyadenylation/transcriptional start
FT                   sequence"
FT   mRNA            5308. .11508
FT                   /gene="L"
FT                   /product="polymerase protein"
FT   CDS             5490. .11441
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QJT4"
FT                   /gene="L"
FT                   /product="polymerase protein"
FT                   /protein_id="AAD56771.1"
FT                   /translation="MEFFDLDLEVSQERLPAECSLNAPLNLSLSLQLFGRIEPKTENIR
FT                   RQSRRITKVLRERHNGYRLQDLIIDSTRTQANLIPHLVSSASGDLNTPILEHWEMLSKY
FT                   YQSLGYSLPSLDKFDFKESAGYWNAACSFRDMLLKSQKVEKKVNKQQTYVIYDITFEFV
FT                   EGVVFIHGGEDGFNDGFLAGGAIAAMTYTELLALFKILNQRAQALLMCNISKGLEPDMV
FT                   PSPSTIHSIYAEADHMLRMAGQGAIDLLKLWEPLVLTQLGDVLGDRFGLEDDFKLTIRT
FT                   EAALLADQLNLKRSFARMTELIKSETRKQPLFQLFGLFKHFAYPRVYSRDTINTILGVS
FT                   DKPSANDPEEYLHDQCEIRKEFYTRYVKAYHRAPQLDLGGLSPGSYLRRALEAGKMPNE
FT                   KSPLYTNLEWFFVKFKKSIEWPLSDTLSTFLSDKAITQNRSTWLDNETSSRDNSEKRLL
FT                   LKFIKENEDSVARVVAQAKEIYDNEDDRIIALKVKEMELKLKGRGFGLMTFKPRLLQVL
FT                   RESIAKKTSKLFPEITMTASDLDLKKRKFLVSRKSDDRRGYVHMSKSLDINKFCTSQRQ
FT                   FNSQAVFQCLDELLGTGALFSRVHEIFEKTWIVDGSASDPPNLKKFKDRYQKLKDLGID
FT                   APHTWGDGVFSGLMGGIEGLCQYVWTICLLLRVERVLSKTSLTHFVMAQGDNVIINLII
FT                   PIEIERDGSISPSEHRRVKSLSTSIDTQLAMELEKSGLTLKIEETLSSEHISIYGKDLH
FT                   CPHHLTLSLKKAGSASIISSEQYQDVPTFLAGLSTSIETISECVNDKVSAHLFGVILAH
FT                   AGWKSLCVSQTWKGWEYPYQKDETINRVRSQGIKLTEGEQVTVEKRLERNPDKRCLEWI
FT                   LATSFLGSALGMLPFPTPVDLEKRGVGDYITHRLALTKKALSSRVLPRRIEKLIRSMVN
FT                   LPHSRETDLAKLFDSPFSLNLATEEDATSVIKRLARSTLRDLDIKNERLRAHIDIMDRG
FT                   LQDLDRELGDSETINPRVAHLIRDITDEKESEMFVTKFATARTMRTVALENPQDVSVVS
FT                   LLNKKSRAKETYTIWRSKRAPAEDWECSTQRAKIERDSSWGKNVIGVTSPSPVEAMSYR
FT                   LVDPSTWEEEKKDQDFTINYYLSKPSLISHQARLERGPLVPYYGTQTQPLIAKAYNELK
FT                   GNPKTNKALMLLSLRETIVKSGSNLDKLIMRLCERALDLDLNTLPSLRAQEEASSGEGI
FT                   RGGIKESMSPVGPDNFYTNITHKVFNRRWLSGFHINIADFIIWGLTCTRKSITTQGTLS
FT                   GNLPICIPACRGCLRRKEREFLDIDNPPRWECKEGVKDKAYMYFTTWCDLPRLSTLPSL
FT                   DPQDAVFMIGRQLACSKGQDSGAATKFYNVSPESLGLLHPRMLLLGYSEGLIFSYLRSQ
FT                   HIVLGCLYHPTITELLPSLEKYTLETIDQHARQLGYLFQEEETAKELLNAGLCPYTPRA
FT                   IPLTITELKNAVCITVSRSISVTLETKKSIHLMPESGISEEEVVAGRHAARTLGGLLNI
FT                   KVPNLVYIDCDLTKGLLPWEPELPSEVLQSENFKIDGKRVTLYAKSQKRDNSIWEERGW
FT                   TCSNSREILAKGVKTKSLFIHQSVPSHLDIDPALIVVIGGGLGGCVVPYLQHWRRPPVI
FT                   FTTLFSERERISEDGDLIIPPELLVRGLSGRMVERELLEAELCDVTVPGNRKAIVDAVK
FT                   RRIKPNESVLLIDEIENRGDAEDVLQQSISTLLQSLEKHCSLTSVHTIRESNVKHFTQR
FT                   LNILRRGRYEANLFWNRYNRRDQYEALIVIPSESRMTECTFSVASVQAAFQKIDDGIEV
FT                   EAKLEAHSWGLPELPPREKKILLGYVSSVFLKLGLVVIERHMSSTKLIDLLESAGPQMI
FT                   SWEEKQTHRSWASTDSIKEKGVTQDRIMALLCFAWTLKGLKHGVWDTNMDAVVEKTVYI
FT                   THGPRLCALDEKPRVQYAEFKLQSKKRVEDLKGYLGALLHLETFFPLGDR"
FT   polyA_signal    11496. .11508
FT                   /gene="L"
FT   misc_feature    11509. .11550
FT                   /note="trailer sequence"
XX
SQ   Sequence 11550 BP; 3466 A; 2780 C; 2869 G; 2435 T; 0 other;

AF147498  Length: 11550  December 21, 2001 14:53  Type: N  Check: 1190  ..

       1  gtatcaaaaa agatgatgat acttggaaga agagatgaag gaaaagaaaa
      51  agatggcacg taagttgcaa agagtttcag tttaccaaaa cagaaagccc
     101  tagaaacaag cgtgagatat cagaatctga cacagaggag agatatcaag
     151  aatcaaaccg agacaatcac aagatggctt ttcagaaaga gttctttgga
     201  ctgagagatg tgaaagtgga tttatccgct ggagagggat tggactttga
     251  cccatccgag gttgaattga ccgtttatcg gaccggggct gatactgatg
     301  gaaacaccat catcaaggcc ttggctgcag tgggtggccc aaagaccaat
     351  gaggccctat ctgtgctttt ggcttttgtc acgttaggca cagatcaaga
     401  tgaatatgag accaggatta agatcttgaa agagattgga ttcagtgtaa
     451  aggaggttcc catggcgaaa gatgcaagtt cggggattga ggcgccgctg
     501  gagaatgttg cagcattagt caagcccgag actgtctatc aggtcatcag
     551  gggagtattg tacacatgcg cgttatttgt taagtataat gtggaaaaga
     601  tgcagaagta catcaagaat aaactacctg cactggctac cagttacgga
     651  gtgcccgagc tagaagagtt tccgaccgag tcctccgccc tcaagaagtt
     701  ggccagttgc attcgacccg ggcagaggat taccaatgcc ctctatgctt
     751  tcctcctggt agaaatggcg aggccagaga cccagcaagg agccagggcg
     801  ctcgcagcta tgagaatcaa cgggacaggg atgactatgg tgggtctctt
     851  cactcaggcg gcaaagaatc tgggagccac accttctgac ctcctggagg
     901  atctttgcat gagatccctt gtggactctg caaggaggat cgtacgactg
     951  atggtccagg tatctcaggc tgaaaccatc caggcccgct atgctgtaat
    1001  gatgagcagg atgttgaatg agaattactt caaggcctat gggctcaacg
    1051  acaactcacg aatttccgca atcctggttg ctgtgaatgg tcacttcagt
    1101  gaggacacca ttgaggcact ggagggaatc aaggtctccg cagagttcgc
    1151  tgacctcgcc cgcaggattg caatcgctct aattgaaaag tatgacaatg
    1201  caagtgatgg aggagaggga gcatccgaga tcatcaagag tgctgtccgt
    1251  gggtcatccg gggctttcaa aggatcccga gggaaaccac agggaagaag
    1301  acaagaggcc tcgggggagg gggatcttga ctcagaagat gatgacgatc
    1351  aggactacag caagtatgcc taaaacagaa cttcccccct aacgagtgac
    1401  cacagaaggt caaatcatga attgcgatga ttgtgtctgg ctaaccagcc
    1451  aaaacatggt gaactggagg gggactccag atcacagcca cccctcggag
    1501  agtagataga aaaaaacggc acgagagtgc ttaaatcttt gaaacccaaa
    1551  caacccgccg ccaagacaca agagaacctt caggaggatg gcagaatcga
    1601  tcgagatggg agaagaactt gtatccagtc cctccaccct gctggccctg
    1651  aaaggcaagc tagagaaccc gtcccctgac gatgccacga ttctgggaat
    1701  cctgggcaaa aaaacgccaa ctgtcaaaat ggagaagggg aaagggaaag
    1751  gtgacccaat tgaagcattc ctactggagt tcgtagatga gaggaggcaa
    1801  gttgaggcaa acaaaagact gagacagtac attagacaac ttaagatgag
    1851  ccatcaggaa gaactgaccg ctcatctcga gagggcctcc gcagaaaaca
    1901  gagcaaatct caagtccatg atggaatctc aggctgaatc caacaagacc
    1951  acaaaaacca tcctagctac tctgatcact ctacgagacc acgtcataga
    2001  agaagggtcc aagaaaccca gaggcctaga taaagatcaa atcaaattag
    2051  agagagctct aggttttgag agggggtaca gctcagccat cgccatcgtg
    2101  aatcagctca aggtgaccga gccctctcaa gtctgcaaac catctgtgag
    2151  ggcagcagca ctgtcagcca tggagaaagg agagtttgag agctccgggg
    2201  aggtgttcaa ggccgtagtt aagagggcga aggctgaact cacaaagtga
    2251  ccacccacac ccaactcagg ctcaaagtca gcatagacag aaaaaaatgg
    2301  cacgagagtg ctaaaatcct gacagaagag cggaatcgag aaaaacggat
    2351  caaaagagat caaaatgccc ttcattcgtc gtcctaaacg agcaattctg
    2401  ataccccccc tacatctcac actgaaggat gatgacaaag tgttggtggt
    2451  tgagaccgtg gggaccctga tcatatcagg gatgactccc agtaacctca
    2501  cagagaaact gggtcttgcc atgaaacttg caagtgcaat tctagggggc
    2551  gactctcatc ccgcattcaa tcctctagtt gaaatattca gtggggcaat
    2601  ggaatttggg gcctcagtgg agaaactgga cttcatgacc cgggagaaca
    2651  aagtcataac cacctacaaa gtcgcccgtg gtaaggctgt tgccctatcc
    2701  aactttccca tggagaaacg agttggagag aaaagctaca ccacccagat
    2751  caggaatggg agtatcacct atacagggtc cttcctattc tctgcggagc
    2801  atgtcggact gaaggataac cggagtttgt ttgcagcggg ggagggactt
    2851  agagagagcc ccgacatggc acaggccagg gaagcctttg cagggtccct
    2901  accaaaggga aagaacgagt cctcaagaaa gtgaacctga gaaggagaaa
    2951  caggggaatg gcaatcggtg tcaaaaatct ggggaaatga gcgatcaggc
    3001  tatcgggcac tggaagagcc cggacaccca tcccagaccc ctggtctgca
    3051  ggaccacccc gatacaccca gccgtctgaa gtccccatca atatgacccg
    3101  catggcgaac ccaagaaaga caactctcca tctcctcaca agaaagacag
    3151  aaaaaaatgg cacgagagtg cttaaatcta acagaacaag gtcttagctg
    3201  caatgacgct cccaaacatg aaaccaaaga ggattgtcct gtttctggtg
    3251  ttcttgaatg cctgggtctc caatgctcag gtgactcaca agccgagacc
    3301  agatagcatt gtcgagtact cggaagaatg ggaaaatccc atatacacaa
    3351  cccccagcca ctgctttgaa gacacattcg cccccgttaa accggagaaa
    3401  ctgcgttgtc cccacatatt tgatgaccag aatctaggcc tcacagcatc
    3451  aaaggcgaaa atcctgcaca tggacctcaa accagaagat acccattttg
    3501  aggccaaggg aagactcctc cacaaggtga catatcaagt tctttgttcc
    3551  acagggttct tcggaggaag gaccgtgact cgaaaagtcc tggaaactcc
    3601  catgggggac aatgaggccc aagcctacaa ggcagtggat cgagagtttc
    3651  cttatttccc tgagccgctc tgtttttggt tgcgagacaa tgtcgcagcc
    3701  gagcgagttt ttcatttttc caccccaaaa acagtgacgg tcgatctcta
    3751  cagtagaaag tacatcagcc cagacttcgt agggggacag tgtgccaagt
    3801  cgccctgccc cactcattgg ccaaacgttt attgggtcgg ggaaactcaa
    3851  tcccctgaat gtccctccat tgatacagaa ggggggcaca ttttcaccaa
    3901  gaaggacacc catcggataa ccaaagcagt tgtgcatgga caccatccct
    3951  ggggattaac caaggcctgt caaatccaat tttgcaatga acagtggatc
    4001  aggactgacc taggggatct tataaggatt gaacctaatg atgggaccag
    4051  ttcacttact ctcccaaaat gtcaggacaa tgtcgttcag atgagaggga
    4101  acctggatga tttttcctat ctgaaccacg caattgttaa catggcgcag
    4151  agatctgagt gtctagaagc tcacagttct atcgtcgctc agcaaaaggt
    4201  ctccccttac ctgctttcca aattcagacc tccacaccct ggactgggga
    4251  aggcacacta cttacaaaac aacaccatca tgagagggga ttgcatctat
    4301  gagggagtgg ccgaaatctc cgaaaacagg acaacataca gaaacttaaa
    4351  gggcgaatgg aagaagtggt ctctgagtag ggggggggaa ggatacgacg
    4401  gcatgacagt cggaacaaag attgtcatcc cagatctaga gaagtatcaa
    4451  agtatttatg acaacggtat gttcatccct aagcttctcg gagaggtccc
    4501  tcaccccagc atagtgataa cctacaatca gaccgactca atagagacag
    4551  gcatcttcac agatggtaag ctgctcaaca tgggtgtaaa ttggactctc
    4601  tggccatctc tctcgggtat ctcactcttc actgtggcct ctttgatcct
    4651  catctggtac tgctgctgcc gagtgactcc gcaagccctg aactattcaa
    4701  tcccgatgca caccatcacc agcaggggag tagagatctg atgcggtcac
    4751  tcaggcccca tcacagtgtc actccaagaa gtcgggaccc ccaagagact
    4801  caagcccaat cacgagacag aaaaaaaacg gcactatagt gcacaatcaa
    4851  agaaccgtcc aagcacaccc aggaacagaa gaacgaaact gccaacatgc
    4901  ccggcaacaa ccacaatgac cgccccgtcg ccctaataat gtcccgcctc
    4951  tctcgcgacc ctagagactg catccatcac accgttgaca cccgaggcat
    5001  gacccccgga aaaatcatcc atcaggtgat ccctcctcat ccgacccaaa
    5051  tgaggcacac aaatcgcccc tcgccccctg tcatcctcaa cttgcagatc
    5101  ctctcagaag ggggacacgt ctgtgcaagg gatgtggaca ccgcagaccc
    5151  agtcccaaga gcaggacccg agagaaccat ccagtggggc acggaccggg
    5201  acgccacaga agaactagca tctcctgccc cagaggagat atatgaagac
    5251  aacgactcct ggtagagaaa ctagatgtcc catcttcttt atagatagaa
    5301  aaaaacggca cgtaatgtgc ttaacgaatc gtagcagaag aaaaggagaa
    5351  gaattcattc tcaagcagga acaccacact tcaaacctcc aaacacccct
    5401  cctcaggacc aaagacctca aagactaggc cctccatcaa cccacaacgc
    5451  cccagtccca ttcaatcccc cgactgaaac ggacaggaga tggaattttt
    5501  tgatctggac ctcgaggttt cacaagagcg ccttccagca gaatgctcac
    5551  tgaatgctcc tctaaacctt tcattgtctc tccaactatt tgggagaatc
    5601  gagccaaaga cggagaacat caggagacaa tccagaagga ttaccaaagt
    5651  actcagggaa agacacaacg gatacaggct ccaggattta atcatagact
    5701  caactaggac tcaggccaac ctaattcccc acctggttag ctctgcctct
    5751  ggtgacctca acactccgat cttggagcac tgggaaatgt tgagtaagta
    5801  ttaccagtca ttagggtact cacttcctag cctcgacaag ttcgacttca
    5851  aagagtcagc tggatactgg aacgccgcat gttcttttag agacatgctc
    5901  ttaaaaagcc agaaagtcga gaaaaaagtc aataaacagc aaacatatgt
    5951  catttatgat atcacctttg aatttgtgga gggtgtggtg ttcatacacg
    6001  gaggtgaaga cgggtttaat gacggtttcc tggcaggagg agcaattgca
    6051  gccatgacct atactgagct cttagctcta tttaaaatct tgaatcagcg
    6101  agcccaagct ctcttgatgt gtaacataag caaaggactt gaaccagaca
    6151  tggtgcccag tccctccact attcactcga tctatgcaga ggctgaccac
    6201  atgctaagaa tggcgggaca aggtgccatc gatctactaa agctgtggga
    6251  acctctggtc cttactcaat taggtgacgt actgggcgac agatttgggc
    6301  tggaagacga cttcaaatta actatcagaa cagaggcggc gctgctcgcc
    6351  gatcaattga atctcaagag gagcttcgca aggatgactg agctaatcaa
    6401  gtcagagaca cgcaagcagc ctcttttcca gctattcgga ttgttcaagc
    6451  actttgctta cccccgggtt tactcaaggg atactatcaa tactatcttg
    6501  ggggtcagtg acaaacctag cgcaaatgac ccagaggagt acctacatga
    6551  ccaatgtgag attcgaaagg aattctacac gagatatgtc aaggcatatc
    6601  accgtgcgcc ccaactggac ctgggaggat taagtccagg gtcttacctg
    6651  agaagagcac tggaggcagg gaaaatgccg aatgaaaaga gtcctttgta
    6701  cacaaatttg gagtggtttt ttgtgaaatt caagaagagc atcgagtggc
    6751  ctctcagtga cacgctctct acattcctct ctgacaaggc aatcacccaa
    6801  aataggagca catggctgga caacgagacg tcgtccagag ataattctga
    6851  aaaacgattg ctcctcaagt tcatcaaaga aaacgaggac agtgtcgcaa
    6901  gggtcgttgc ccaagccaaa gaaatttacg acaatgaaga cgacagaata
    6951  attgctctca aagtcaaaga aatggagctg aaactcaaag gtcgggggtt
    7001  tggactaatg acgttcaagc cccgtctgct ccaagtttta agagagagca
    7051  ttgcgaagaa aactagcaaa ctgttcccag aaatcaccat gactgcatct
    7101  gatctagatc tgaagaaaag gaagttcctc gtatcccgaa agagtgatga
    7151  caggaggggg tatgtgcaca tgagtaaaag ccttgacatc aataagttct
    7201  gcaccagcca gcgtcagttc aactcacagg cggtgtttca gtgcctggac
    7251  gagctactcg gaactggagc ccttttttca cgagtccacg agatatttga
    7301  gaagacttgg atcgtggacg gttcagctag tgatcctccc aacctaaaaa
    7351  agtttaagga tagataccag aaactcaagg acttggggat tgacgcacca
    7401  cacacctggg gagatggagt gttctccggg ctaatggggg ggatcgaagg
    7451  gctgtgtcag tatgtctgga caatttgtct tttgttgaga gtcgaacgag
    7501  tgctctccaa gacaagtctg acccacttcg tgatggcaca gggagacaat
    7551  gttatcataa acttgatcat cccaattgag atcgagaggg atgggtcgat
    7601  atcaccatca gaacatcgga gggtcaagtc cttgagtacc tcgattgaca
    7651  cccagcttgc aatggagctt gagaaaagtg gattgacctt gaagatagaa
    7701  gagacactca gcagtgagca catctccatt tacggaaaag acctccattg
    7751  tcctcatcac ctaaccctgt ccttgaaaaa ggcaggatcc gcctccatta
    7801  tctctagtga acagtatcaa gatgtgccga cctttctagc aggccttagc
    7851  accagcatag agactatctc tgagtgtgtc aacgacaaag tcagtgccca
    7901  cttatttggg gtgatcctcg cacatgccgg gtggaagagc ctctgtgtga
    7951  gtcagacttg gaagggatgg gaatatccct atcagaagga cgagacgatt
    8001  aacagggtta gaagtcaagg aatcaaactc acagagggag agcaagtaac
    8051  tgtcgaaaaa agactagagc gaaatccaga caaacgatgc cttgaatgga
    8101  ttcttgccac cagtttcctg ggatcggccc tcggaatgct cccctttccc
    8151  actcccgtag atctagagaa acgaggtgtt ggggactaca tcacccatag
    8201  acttgcactc acaaaaaagg cgctgagctc cagggttctc cctcgtagaa
    8251  tcgagaaatt gatccggtcc atggtcaatt tacctcactc aagggaaact
    8301  gacttggcga agttgttcga ttcacccttt tcactgaact tggcaaccga
    8351  ggaagatgca acgtctgtga taaaaagact ggcccgatcc acgctccggg
    8401  acctggacat caaaaacgag cgacttcgtg cccacatcga tataatggac
    8451  agaggtcttc aagaccttga tcgagagtta ggtgactctg aaaccatcaa
    8501  tccaagggtg gcacacctca ttcgggacat cacagatgag aaggaatcgg
    8551  agatgtttgt caccaaattt gccactgcaa ggacaatgag gacagtggcc
    8601  ttggagaatc cccaagatgt ctcagttgtc agcttactca acaagaagag
    8651  tcgagcaaag gagacgtaca caatctggag atcaaaaaga gccccagcag
    8701  aagactggga atgctcgact caacgagcaa aaatagaacg agactcttca
    8751  tggggaaaaa atgtgatcgg tgtgacctcc ccctcacctg ttgaggccat
    8801  gagctatcga ctagttgacc cgagcacctg ggaggaagag aagaaagacc
    8851  aggacttcac aatcaattac tatctctcta aacccagtct tatttcccac
    8901  caggcaaggc ttgaacgagg acctttagtg ccttattatg ggactcagac
    8951  gcagccactc atagcgaagg catacaacga actaaaagga aatccaaaaa
    9001  ccaataaggc actcatgctc ctcagcctca gagaaactat tgtaaaatca
    9051  ggatccaatc ttgataagtt gataatgcga ctctgtgaga gggcgctaga
    9101  tctagacctt aacacactcc catccctgcg agcccaggaa gaggcgagct
    9151  caggtgaggg gatcagagga gggatcaagg agtcaatgtc gcccgtcggc
    9201  cccgacaatt tctacacaaa tatcactcat aaggtgttca atcgtcgttg
    9251  gttgagtggc tttcatatca atattgcaga tttcatcata tggggactca
    9301  catgcacgag aaaatccatc accacgcagg ggacactgag tgggaatttg
    9351  ccaatttgca tcccagcgtg cagaggatgc ttgagacgga aggagagaga
    9401  attccttgac attgacaatc caccgaggtg ggagtgcaaa gaaggagtca
    9451  aagataaggc ctacatgtac ttcactacct ggtgtgacct cccaaggctg
    9501  tctacccttc ctagtcttga cccgcaggac gctgtgttca tgattgggag
    9551  acaactcgcc tgtagtaaag gtcaagattc gggggctgca accaagttct
    9601  ataacgtctc ccccgagtcc ctaggactcc tacatcccag aatgctgtta
    9651  ttgggatact cggaggggct gatattcagc tacttaagga gccaacacat
    9701  tgtgctgggg tgtctctatc atcctacgat cacagagctg cttccaagct
    9751  tagagaagta cacccttgag acaattgacc agcatgcgcg acaacttgga
    9801  tacctgtttc aagaggaaga aacggcaaag gagctcttga atgccggtct
    9851  ctgcccctac acaccgcgag cgattcccct gacaatcacg gagctaaaaa
    9901  acgccgtctg catcacagtc agccgttcca tctcggtcac tctggagacc
    9951  aaaaagtcga ttcacttaat gcctgagtca gggatttcgg aggaggaggt
   10001  tgtagcgggg agacacgccg cgagaactct aggtgggctc ctgaacatta
   10051  aggtcccaaa tttggtctac atcgattgtg atctcacgaa gggactcctc
   10101  ccctgggaac cagaacttcc atcagaggtg ctgcaatcag aaaactttaa
   10151  aattgatggg aaacgagtaa ctctttatgc aaagagccaa aaaagagaca
   10201  actcaatctg ggaagaaaga gggtggacat gttccaactc aagagagatc
   10251  ctggcgaaag gggttaaaac caagtcgtta ttcatccacc agagtgtccc
   10301  ctctcacctt gacattgatc cggccctcat tgttgtgatt ggaggggggc
   10351  ttggtggctg tgtggtcccc taccttcaac actggagaag acccccagtg
   10401  atcttcacaa cactttttag tgaacgagag cgaatctcag aagacgggga
   10451  cctgatcata ccccctgaat tgctagttag aggcttgtct ggacgaatgg
   10501  tagaacgaga actgttagag gctgaactct gtgatgtgac ggtgcccggc
   10551  aaccggaaag ccatagtgga tgcagtaaag agaaggataa aacccaatga
   10601  gagtgtgcta ctgattgatg agatcgagaa tcggggggat gcagaagacg
   10651  tccttcagca atccatcagc actcttttgc agtcattgga aaaacactgc
   10701  tccctgacat ctgtgcatac catcagggag agcaatgtga agcactttac
   10751  ccagaggttg aacatcttga ggagagggcg atatgaggca aatttatttt
   10801  ggaaccgtta caacagacgt gatcagtatg aggccctcat tgtgattccc
   10851  agtgaatcta ggatgacaga gtgtaccttc tccgttgcgt ctgtacaggc
   10901  tgcgttccaa aagatagatg atggaattga ggtagaagca aaactagaag
   10951  cccacagctg gggattgcct gagcttcccc ctcgagagaa gaagattctg
   11001  ttgggatatg tctcatccgt attcttaaag ctggggttgg tagtgataga
   11051  gaggcacatg agctcaacta aattgatcga tctacttgag tctgcgggac
   11101  cgcagatgat ctcatgggaa gagaaacaaa cgcatagatc ttgggctagc
   11151  acagacagca tcaaggaaaa gggagtgaca caagacagga tcatggcact
   11201  tctgtgcttc gcgtggactc tgaagggact taaacatggg gtctgggaca
   11251  cgaacatgga tgcagtagtt gagaaaactg tctacataac ccacggacca
   11301  agactttgcg cacttgacga gaaacctcga gttcagtatg ctgaattcaa
   11351  gcttcagagc aagaaaagag tagaagatct taaaggatac cttggagcgc
   11401  tccttcacct tgagaccttc ttcccgttgg gggatcgctg atcaggacaa
   11451  acgagaaaga ggtcaacgct tctaaaacca tgaagcaaac acagcagaca
   11501  gaaaaaaact ggatttgtcc tagaaaaaaa tatatcatct ttttctatac