Sequence of DPV Koala retrovirus

Phascolarctos cinereus retrovirus KoRV long terminal repeat, complete sequence; gag protein (gag), pol protein (pol), and envelope protein (env) genes, complete cds; and long terminal repeat, complete sequence.

ACC No: AF151794

Dated: 2005-04-15 | Length: 8431 | CRC: 1515584465

                
ID   AF151794; SV 2; linear; genomic DNA; STD; MAM; 8431 BP.
XX
AC   AF151794;
XX
DT   14-DEC-1999 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Phascolarctos cinereus retrovirus KoRV long terminal repeat, complete
DE   sequence; gag protein (gag), pol protein (pol), and envelope protein (env)
DE   genes, complete cds; and long terminal repeat, complete sequence.
XX
KW   .
XX
OS   Phascolarctos cinereus (koala)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos.
XX
RN   [1]
RP   1-8431
RX   DOI; 10.1128/JVI.74.9.4264-4272.2000.
RX   PUBMED; 10756041.
RA   Hanger J.J., Bromham L.D., McKee J.J., O'Brien T.M., Robinson W.F.;
RT   "The nucleotide sequence of koala (Phascolarctos cinereus) retrovirus: a
RT   novel type C endogenous virus related to Gibbon ape leukemia virus";
RL   J. Virol. 74(9):4264-4272(2000).
XX
RN   [2]
RP   1-8411
RA   Hanger J.J., McKee J.J., O'Brien T.M., Robinson W.F.;
RT   ;
RL   Submitted (15-MAY-1999) to the EMBL/GenBank/DDBJ databases.
RL   Veterinary Pathology and Anatomy, University of Queensland, St. Lucia,
RL   Brisbane, Queensland 4072, Australia
XX
RN   [3]
RC   Sequence update by submitter
RP   1-8431
RA   Hanger J.J., Bromham L.D., McKee J.J., O'Brien T.M., Robinson W.F.;
RT   ;
RL   Submitted (03-MAR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Veterinary Pathology and Anatomy, University of Queensland, St. Lucia,
RL   Brisbane, Queensland 4072, Australia
XX
DR   RFAM; RF01073; GP_knot1.
XX
CC   On Mar 3, 2000 this sequence version replaced gi:6524622.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8431
FT                   /organism="Phascolarctos cinereus"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood; bone marrow; neoplastic lymphoid
FT                   cells"
FT                   /db_xref="taxon:38626"
FT   repeat_region   1. .8431
FT                   /rpt_family="endogenous retrovirus koala KoRV type-C"
FT   LTR             1. .505
FT   CAAT_signal     290. .293
FT                   /note="U3 region"
FT   TATA_signal     331. .336
FT                   /note="U3 region"
FT   polyA_signal    408. .413
FT                   /note="R-region"
FT   primer_bind     506. .523
FT                   /note="tRNA-Pro"
FT   CDS             961. .2526
FT                   /codon_start=1
FT                   /gene="gag"
FT                   /product="gag protein"
FT                   /db_xref="GOA:Q9TTC2"
FT                   /db_xref="HSSP:1A6B"
FT                   /db_xref="InterPro:IPR000840"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR003036"
FT                   /db_xref="InterPro:IPR008919"
FT                   /db_xref="InterPro:IPR010999"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9TTC2"
FT                   /protein_id="AAF15097.1"
FT                   /translation="MGQGESTPLSLTLDHWKDVKTRAHNLSVEIRKGKWQTFCSSEWPT
FT                   FEVGWPPEGTFNPSIISAVKRIVFQETGGHPDQVPYIIVWQDLSNSPPPWVPPLAKIAV
FT                   ASGQDNGRKSAGGRPSAPSRLPIYPETDSLFLLSEPPPYPTSPPPPPAPHAARPAPGLM
FT                   AEGLGSEGPAAGTRSRRPRSPTGDTGPDSTVALPLRAVGPPAEPNGLVPLQYWPFSSAD
FT                   LYNWKSNHPSFSENPTGLTGLLESLMFSHQPTWDDCQQLLQVLFTTEERERILLEARKN
FT                   VLGVNGAPTQLENLINEAFPLNRPQWDHNTAEGRERLLVYRRTLVAGLKGAARRPTNLA
FT                   KVREVLQGPTEPPSVFLERLMEAYRRYTPFDPSSEGQKAAVAMSFIGQSAPDIKKKLQR
FT                   LEGLQDHSLQDLIKEAEKVYHKRETEEEKQEREKKETEERERRRDRRQEKNLTKILAAV
FT                   VSEKGFRGRQAGNLSNRAMRAPREGRPPLDKDQCAYCKERGHWARECPRKKNARETNVL
FT                   TLGD"
FT   misc_feature    2434. .2475
FT                   /gene="gag"
FT                   /note="nucleic acid binding; Region: Cis-His box"
FT   CDS             2641. .6024
FT                   /codon_start=1
FT                   /gene="pol"
FT                   /product="pol protein"
FT                   /db_xref="GOA:Q9TTC1"
FT                   /db_xref="HSSP:1RW3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001995"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018061"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9TTC1"
FT                   /protein_id="AAF15098.1"
FT                   /translation="MGKMGSKRTVVAGATGSKVYPWTTKRLLKIGQKQVTHSFLVIPEC
FT                   PAPLLGRDLLTKLKAQIQFSTEGPQVTWEDRPAMCLVLNLEEEYRLHEKPVPPSIDPSW
FT                   LQLFPMVWAEKAGMGLANQVPPVVVELKSDASPVAVRQYPMSKEAREGIRPHIQRFLDL
FT                   GILVPCQSPWNTPLLPVKKPGTNDYRPVQDLREVNKRVQDIHPTVPNPYNLLSSLPPSH
FT                   TWYSVLDLKDAFFCLKLHPNSQPLFAFEWRDPEKGNTGQLTWTRLPQGFKNSPTLFDEA
FT                   LHRDLASFRALNPQVVMLQYVDDLLVAAPTYRDCKEGTRRLLQELSKLGYRVSAKKAQL
FT                   CREEVTYLGYLLKGGKRWLTPARKATVMKIPTPTTPRQVREFLGTAGFCRLWIPGFASL
FT                   AAPLYPLTREKVPFTWTEAHQEAFGRIKEALLSAPALALPDLTKPFALYVDEKEGVARG
FT                   VLTQTLGPWRRPVAYLSKKLDPVASGWPTCLKAIAAVALLLKDADKLTLGQNVLVIAPH
FT                   NLESIVRQPPDRWMTNARMTHYQSLLLNERVSFAPPAILNPATLLPVESDDTPIHICSE
FT                   ILAEETGTRPDLRDQPLPGVPAWYTDGSSFIMDGRRQAGAAIVDNKRTVWASNLPEGTS
FT                   AQKAELIALTQALRLAEGKSINIYTDSRYAFATAHVHGAIYKQRGLLTSAGKDIKNKEE
FT                   ILALLEAIHLPKRVAIIHCPGHQRGTDPVATGNRKADEAAKQAAQSTRILTETTKNQEH
FT                   FEPTRGKIKPRELTPDQGREFIQRLHQLTHLGPDKLLQLVGRTSFHIPNLQSVVREITS
FT                   KCQVCAVTNAVTTYREPGRRQRGDRPGVYWEVDFTEVKPGRYGNRYLLVFIDTFSGWVE
FT                   AFPTKTETALTVCKKILEEILPRFGIPKVLGSDNGPAFVAQVSQGLATQLGIDWKLHCA
FT                   YRPQSSGQVERMNRTIKETLTKLALETGGKDWVTLLPLALLRARNTPGQFGLTPYEILH
FT                   GGPPPVLASGEVVGSNGDFFPVLFTHLKALEVVRTQIWDQIKEAYRPGTVAIPHPFQVG
FT                   DRVLVRRHRSGSLEPRWKGPYLVLLTTPTAVKVDGIAAWVHASHLKPAPPGAPDESWEL
FT                   EKTDHPLKLRVRRRRNESTA"
FT   CDS             5906. .7885
FT                   /codon_start=1
FT                   /gene="env"
FT                   /product="envelope protein"
FT                   /db_xref="GOA:Q9TTC0"
FT                   /db_xref="HSSP:1MOF"
FT                   /db_xref="InterPro:IPR008981"
FT                   /db_xref="InterPro:IPR018154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9TTC0"
FT                   /protein_id="AAF15099.1"
FT                   /translation="MLLISNPRHLGHPMSPGNWKRLIILLSCVFGGAEMNQQHNNPHQP
FT                   MTLTWQVLSQTGSVVWEKKAVEPPWTWWPSLEPDVCALVAGLESWDIPELTASASQQAR
FT                   PPDSNYEHAYNQITWGTLGCSYPRARTRIARSQFYVCPRDGRSLSEARRCGGLESLYCK
FT                   EWGCETAGTAYWQPRSSWDLITVGQGHPTGTCERTGWCNPLKIEFTEPGKRFRNWLQGR
FT                   TWGLRFYVTGHPGVQLTIRLVITSPPPVVVGPDPVLAEQGPPRKIPFLPRVPVPTLSPP
FT                   ASPIPTVQASPPAPSTPSPTTGDRLFGLVQGAFLALNATNPEATESCWLCLALGPPYYE
FT                   GIATPGQVTYASTDSQCRWGGKGKLTLTEVSGLGLCIGKVPPTHQHLCNLTIPLNASHT
FT                   HKYLLPSNRSWWACNSGLTPCLSTSVFNQSNDFCIQIQLVPRIYYHPDGTLLQAYESPH
FT                   SRNKREPVSLTLAVLLGLGVAAGIGTGSTALIKGPIDLQQGLTSLQIAMDTDLRALQDS
FT                   ISKLEDSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYVDHSGAVRDSMRRLKE
FT                   RLDKRQLEHQKNLSWYEGWFNRSPWLTTLLSALAGPLLLLLLLLTLGPCVINKLVQFIN
FT                   DRVSAVRILVLRHKYQTLDNEDNL"
FT   misc_feature    7913. .7930
FT                   /note="PPT polypurine tract; viral DNA synthesis"
FT   LTR             7927. .8431
FT   CAAT_signal     8216. .8219
FT                   /note="U3 region"
FT   TATA_signal     8257. .8262
FT                   /note="U3 region"
FT   polyA_signal    8334. .8339
FT                   /note="R-region"
XX
SQ   Sequence 8431 BP; 2084 A; 2352 C; 2169 G; 1826 T; 0 other;

af151794 Length: 8431  15-APR-2005  Type: N  Check: 5512  ..

       1  aatgaaggag gcagaaatca tgaggcagaa atcattccgt ggagtatgga
      51  aactacccgg agggcccaag gtttagggac aggtgcagcc aggcacagta
     101  aaaggtcaga gcaagaaaaa caaggaagat ttggagtgcc aaacgggata
     151  tctgtggtca tgcacctgag tccccacccc ggacttatgc aaacaattcc
     201  cagaaatagc tgagctcata acagtttcta gggtgcccct cagcagtttc
     251  tagaaccctc tcgtgaccgg agtttttatt caaactaacc aatgatcttg
     301  ctcctcgctt ccgtacccgc gcttttttgc tataaaatga gaccaaagaa
     351  tccacctggc gcgccagtcc ctctaggtga ctgagtcgcc cgagtactcg
     401  taagttcaat aaacctcttg ctatttgcat ccggagttgt gttcgcgttg
     451  atcctgggag ggtttctcaa ggtcggagga ctacccgaac attggggtct
     501  ttcatttggg ggctcgtccg ggatctgaga ttcccaccca aggaccgccg
     551  aaccaccgac gggaggtaag ctggccagcg atcgctctat gttctctctg
     601  tgtctgactc cgaaaactct gactgtctat tcggtgtgcg cgcatttttg
     651  gtttattccg ggttaatcga tctaagatcg aggcgtgagt agcggacaga
     701  cgtgttcggg ggctcaccgc ccggcaatcc tgggagacgt cccaggatca
     751  ggggaggacc agggacgcct ggtggatccc acggcaaggg ataattctcc
     801  tctgatctca cagttgcact gtcttgagag acatacccta ccttctgact
     851  ctttttcctg tctttttaat atacgtctac gccgccatat aatttttttc
     901  ctttttattt caataataat cattatctgg gtcgtaattc cactcttcgg
     951  gacccccaga atgggacagg gtgagtcgac ccctctctct cttacactag
    1001  atcactggaa agacgtgaag acaagggctc acaatctttc cgtggagata
    1051  agaaagggaa agtggcaaac cttctgttcc tccgagtggc ccacgttcga
    1101  agtgggatgg ccaccggagg ggacttttaa tccttctatt atttctgcag
    1151  tcaaaaggat tgtcttccag gagactggag gacacccgga ccaggttccc
    1201  tacatcatag tttggcagga cctctccaac agcccccccc catgggtgcc
    1251  acccttagcc aagatcgccg ttgcctctgg tcaagataac gggcgaaagt
    1301  cggcgggggg gaggccgtcc gctccttccc ggctccccat ctacccggag
    1351  acggacagcc tgttcctcct ctcagaaccc ccgccctatc caacgtcccc
    1401  tccacctccc ccagcccctc acgcggccag accagcgcca ggcctaatgg
    1451  ctgagggact cggctctgag ggaccggccg ctggaactag gagtcgccgt
    1501  ccccgcagtc ctacgggtga cactggtcct gactccactg tggccctgcc
    1551  cctccgggcc gtgggacccc cggccgaacc aaacggctta gtccccttgc
    1601  aatattggcc tttctcctca gcagatctct ataattggaa atctaatcat
    1651  ccttcttttt ccgagaatcc tacaggactt acgggactcc ttgagtccct
    1701  catgttttcc caccagccta cttgggacga ttgccagcag ctcctgcaag
    1751  tcctctttac caccgaggaa agagaaagga ttcttttgga ggctcgcaaa
    1801  aacgtccttg gagttaacgg ggcccctaca caactcgaga acctcattaa
    1851  tgaggccttc ccccttaatc gacctcagtg ggatcacaac acggctgaag
    1901  gtagggagcg tctcctggtc taccgccgga ctctagtggc gggtctcaaa
    1951  ggggcagcaa ggcgccccac caatttggcc aaggtaagag aagtcttgca
    2001  gggaccaaca gaacccccgt ccgtttttct agaacgtcta atggaggctt
    2051  ataggagata taccccattt gatccctctt ctgagggaca aaaggcggcg
    2101  gtggccatgt cctttatcgg gcagtctgcc ccggatatta aaaagaaatt
    2151  acaaaggctg gaaggactcc aggaccattc cttgcaggat ctcataaagg
    2201  aggcagagaa ggtatatcat aagagagaga cagaggaaga aaagcaagaa
    2251  agagagaaaa aggagacaga ggaaagagag agacggcgtg acaggcgcca
    2301  ggagaaaaac ttgaccaaaa tcttggccgc ggtagtaagt gagaaagggt
    2351  tcagagggag acaggcaggg aatctgagca acagggcaat gagggcacct
    2401  agggaaggaa gaccgcctct ggacaaagat cagtgcgcat actgtaaaga
    2451  aaggggccat tgggcaaggg agtgcccccg gaagaagaac gccagggaaa
    2501  ccaatgtcct gaccctgggt gactagggga gtcggggttc ggaccccctc
    2551  cccgagccca gggtaacgtt aactgtggag gggatcccca ctgagttttt
    2601  ggttgatacc ggggccgaac attcagtatt gaccaagcct atgggaaaga
    2651  tgggatccaa acggacagtc gtggctgggg cgacgggcag caaagtttac
    2701  ccttggacca ccaagagact tttgaaaatt ggacaaaagc aagtgaccca
    2751  ctcattcttg gtcatacccg aatgccctgc tcccctgtta ggcagggacc
    2801  tcctcaccaa gctaaaagct caaatccagt tttccacaga gggcccacag
    2851  gtaacatggg aagaccgccc cgccatgtgt ttagtcctga acttggagga
    2901  ggaataccga ttacacgaaa agccggtccc tccttctatc gacccgtcat
    2951  ggctccaact ctttcccatg gtttgggccg agaaggcagg tatgggactg
    3001  gccaatcaag tcccaccagt ggtagtggaa ctgaagtcag atgcctcacc
    3051  agtggctgtt cgacagtacc caatgagcaa ggaagcccgg gagggtatca
    3101  ggccccacat ccaaagattc ttggatttgg ggattctggt accttgccag
    3151  tcgccctgga acaccccttt gttacctgta aaaaaacctg gaaccaatga
    3201  ctatcggcca gtccaagatt tgagggaggt caacaaaaga gtacaggaca
    3251  ttcatcccac agtcccgaac ccctataacc tactcagttc cctcccgccc
    3301  agccacacct ggtattcagt tttagacctc aaagatgctt tcttttgcct
    3351  caagctacac cccaacagcc agccattgtt cgcgtttgaa tggagagatc
    3401  cagaaaaagg caatactggc cagctaacct ggactcggct accgcaagga
    3451  ttcaagaact ctcccaccct cttcgatgag gccctccacc gggatctggc
    3501  atccttcagg gctctcaacc cccaggtagt gatgctccaa tatgttgatg
    3551  acctcctggt agcggcccca acgtaccgag actgcaaaga agggacacga
    3601  aggctcttac aggaactaag taagttggga taccgagtgt cggccaaaaa
    3651  ggcccagctt tgccgggagg aagttacgta tctcgggtat ttgctaaaag
    3701  gggggaagag atggctgacc ccagcccgaa aggccactgt aatgaagatc
    3751  cccaccccta caacccccag acaagtccgt gagtttttgg gcactgctgg
    3801  attctgtagg ctctggatcc ctggtttcgc ttccctggct gcacccctgt
    3851  accccctgac gagagaaaag gttcccttta cctggactga ggcccaccag
    3901  gaagcctttg gccgtataaa agaggccctg ctatcggccc ccgccctggc
    3951  ccttccggac ctcaccaagc catttgctct gtacgtggat gaaaaagagg
    4001  gtgttgcccg gggggtgctt actcaaaccc taggaccatg gcgacgcccg
    4051  gtagcttacc tgtcaaaaaa attagatccg gtggccagtg ggtggccaac
    4101  ttgcctaaaa gcaattgcgg ccgtagcact ccttctcaag gacgctgata
    4151  agttaaccct aggacagaac gtgttggtga ttgcacctca caacctggaa
    4201  agcattgtga gacagccccc cgaccgatgg atgacaaatg ccaggatgac
    4251  ccattaccaa agtctgctgc tgaatgagag ggtgtctttt gcgcccccgg
    4301  ccattctgaa tcctgccacc ctgctccccg tagagtcaga cgacacccca
    4351  atacacatat gctcagaaat ccttgccgag gagacaggaa cccgacctga
    4401  tctgagagat cagccgttgc ccggggtacc cgcttggtat acggatggca
    4451  gcagtttcat catggatggc aggcgacaag caggtgctgc cattgtggac
    4501  aacaagcgga cggtgtgggc gagcaacctg ccagagggaa cgtcagctca
    4551  gaaggccgaa ctaatcgcct tgacacaagc attacgcttg gccgaaggaa
    4601  aaagcatcaa catctacacg gacagcaggt acgcttttgc caccgctcat
    4651  gttcacgggg ctatatacaa acaaagagga ctgctcactt ccgctggaaa
    4701  agacatcaag aacaaagagg agattttggc cctgctagag gccatccatc
    4751  tccctaagcg agtcgctatc atccattgcc ccggccacca aagagggact
    4801  gaccctgtgg ctaccggaaa ccgaaaggcc gatgaggccg cgaaacaagc
    4851  tgcccagtca accagaatac tgacggagac cacgaaaaat caagaacact
    4901  tcgagcctac acgggggaag atcaagccga gagagctcac ccctgaccag
    4951  ggaagggaat tcattcaacg gctgcatcag ctcacgcact tagggccaga
    5001  caagcttctc cagcttgtag gtcgcaccag ttttcacatc ccgaatctcc
    5051  agtctgtagt gcgtgaaatc accagcaagt gtcaggtttg tgctgtaact
    5101  aacgcagtca ccacctaccg agagcctgga aggaggcaaa ggggagatcg
    5151  acccggcgtg tattgggaag tagacttcac agaggttaag cctggccggt
    5201  atggtaatag atatttgcta gtgtttatcg atacattttc tgggtgggta
    5251  gaagctttcc ctacaaaaac agagacagcc ctgaccgtct gcaagaagat
    5301  acttgaggaa atcctacctc gtttcgggat ccctaaggta ctcgggtccg
    5351  acaatggccc tgccttcgtt gctcaggtaa gccaggggtt ggccactcaa
    5401  ctggggattg attggaaatt acattgtgca tatagacccc agagctcagg
    5451  tcaggtagaa aggatgaata ggacaattaa agagaccttg acaaaattgg
    5501  ccttagagac cggtggaaaa gactgggtga ccctcctccc tttggcgcta
    5551  cttagggccc ggaatacccc tggccagttt ggcctgactc cttatgagat
    5601  tcttcatggg gggccgcccc ctgtacttgc gtctggggaa gtcgtgggtt
    5651  ctaatggtga tttttttccc gttctattta cccacttgaa ggctttagag
    5701  gttgtgagga ctcagatctg ggaccagata aaagaagcct acaggcctgg
    5751  tactgtggcc attccccacc cgttccaggt cggtgaccga gtgctggtta
    5801  gacgtcatcg gtccggcagc cttgagcctc ggtggaaagg cccatacctg
    5851  gtgctactga ccaccccgac cgcggtgaag gttgacggta ttgctgcctg
    5901  ggtccatgct tctcatctca aacccgcgcc acctggggca cccgatgagt
    5951  cctgggaact ggaaaagact gatcatcctc ttaagttgcg tgttcggcgg
    6001  cgccgaaatg aatcaacagc ataacaaccc tcaccaaccc atgactctca
    6051  cctggcaggt actgtcccag acgggaagtg tcgtttggga aaagaaagca
    6101  gtcgagccac cctggacgtg gtggccctct cttgagcctg atgtgtgcgc
    6151  gctggtagcc ggtctcgagt cctgggacat cccggaactc actgcatcgg
    6201  cctctcaaca ggccaggccc cctgattcaa actatgaaca tgcttataat
    6251  cagatcactt ggggaaccct gggatgtagc tatccccggg ccagaacaag
    6301  aattgctagg tcccagttct acgtgtgccc ccgggatggc cgttccctgt
    6351  ccgaggcccg gaggtgcgga ggacttgaat ctttgtactg taaagagtgg
    6401  ggttgtgaga ccgcgggaac cgcctactgg caaccccggt cctcgtggga
    6451  ccttataact gtaggccagg gtcaccctac agggacatgc gagcgcaccg
    6501  gttggtgcaa cccactcaag atagagttca ccgagcctgg caaacggttc
    6551  cgaaactggc tacaggggcg aacctggggt ctaaggttct atgtgactgg
    6601  acacccaggc gtgcagttga ccatacgact agtgatcaca agtcccccac
    6651  cggtagtagt gggccccgat cctgtcctcg cagaacaagg acctcccaga
    6701  aaaattccct tcctccccag agtgccggtt cctaccctat cacccccagc
    6751  gtcccctatc cccacggtac aggctagccc cccggcccct agtactccat
    6801  ctcccaccac gggcgaccgg ctctttggcc tcgtacaagg ggcctttctg
    6851  gccttgaatg ccaccaaccc ggaggccacg gagtcttgct ggctctgtct
    6901  agccctcggc cctccttatt acgaaggaat cgcaactcca gggcaagtca
    6951  cttatgcctc cacagattcc caatgtcgct ggggaggaaa agggaagctc
    7001  accctcactg aagtctctgg actcgggtta tgtataggga aagtacctcc
    7051  tactcaccaa catctctgca acctgactat acccttaaac gcctcacata
    7101  ctcacaagta cctcctcccc tccaaccgca gctggtgggc ttgtaattct
    7151  ggcctcaccc cctgcctctc tacatcagtc ttcaaccagt ctaacgattt
    7201  ctgtatccag atccagcttg tccctcgcat ctactatcac ccagacggta
    7251  ccttgctaca ggcctatgag tccccccact ctagaaacaa gagagagcct
    7301  gtctcactca ccctggctgt ccttctcgga ttaggggtcg cagcaggtat
    7351  aggtaccggc tcgaccgccc taataaaagg gcccatagac ctccaacaag
    7401  gtttgactag cctccagatt gccatggata cagaccttag ggcccttcaa
    7451  gactccataa gtaaactaga ggattcctta acctccctgt ctgaagtagt
    7501  gctccagaat aggagaggcc ttgatctgct atttttgaag gaagggggcc
    7551  tttgtgcagc cctaaaagag gaatgctgtt tctatgttga ccactcaggc
    7601  gcggtgcgag actccatgag gagactcaag gaaaggttag ataagaggca
    7651  gttagagcac caaaagaatt taagttggta cgagggatgg ttcaaccgtt
    7701  ccccctggct tactacttta ctgtctgccc ttgctggtcc cctgctactc
    7751  ctccttctgt tactcaccct cgggccttgt gtcatcaata agttagtgca
    7801  attcatcaat gatagggtta gtgcagtaag gattctggtt ctcaggcaca
    7851  agtaccagac cctagacaac gaggataacc tttaattctg ctctatgatt
    7901  agagctaccc tcaaagaaaa tgggggaatg aaggaggcag aaatcatgag
    7951  gcagaaatca ttccgtggag tatggaaact acccggaggg cccaaggttt
    8001  agggacaggt gcagccaggc acagtaaaag gtcagagcaa gaaaaacaag
    8051  gaagatttgg agtgccaaac gggatatctg tggtcatgca cctgagtccc
    8101  caccccggac ttatgcaaac aattcccaga aatagctgag ctcataacag
    8151  tttctagggt gcccctcagc agtttctaga accctctcgt gaccggagtt
    8201  tttattcaaa ctaaccaatg atcttgctcc tcgcttctgt acccgcgctt
    8251  ttttgctata aaatgagacc aaagaatcca cccggcgcgc cagtccctct
    8301  aggtgactga gtcgcccgag tactcgtaag ttcaataaac ctcttgctat
    8351  ttgcatccgg agttgtgttc gcgttgatcc tgggagggtt tctcaaggtc
    8401  agaggactac ccgaacattg gggtctttca t