Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain 19-21 coat protein gene, complete cds.

ACC No: AF184114

Dated: 1999-09-27 | Length: 672 | CRC: 1122409592

                !!NA_SEQUENCE 1.0
ID   AF184114   standard; RNA; VRL; 672 BP.
XX
AC   AF184114;
XX
SV   AF184114.1
XX
DT   27-SEP-1999 (Rel. 61, Created)
DT   27-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain 19-21 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Bonacalza B., Febres V., Niblett C.L., Nolasco G.;
RT   "Biomolecular characterization of Citrus Tristeza Virus isolates from
RT   Portugal";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Sequeira Z., Nolasco G.;
RT   "Bacterial expressed coat protein for the development of a single antibody
RT   for routine detection of Citrus Tristeza Virus in Portugal";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Sequeira Z., Nolasco G.;
RT   ;
RL   Submitted (10-SEP-1999) to the EMBL/GenBank/DDBJ databases.
RL   UCTA, Univ Algarve, Campus de Gambelas, Faro 8000, Portugal
XX
DR   SPTREMBL; Q9QEG5; Q9QEG5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="19-21"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QEG5"
FT                   /product="coat protein"
FT                   /protein_id="AAD56567.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 129 C; 166 G; 177 T; 0 other;

 AF184114  Length: 672  December 21, 2001 14:54  Type: N  Check: 9  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgac gttgttgccg cggagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtagatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga