Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain 2-93 coat protein gene, complete cds.

ACC No: AF184116

Dated: 1999-09-27 | Length: 672 | CRC: -1170233212

                !!NA_SEQUENCE 1.0
ID   AF184116   standard; RNA; VRL; 672 BP.
XX
AC   AF184116;
XX
SV   AF184116.1
XX
DT   27-SEP-1999 (Rel. 61, Created)
DT   27-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain 2-93 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Sequeira Z., Nolasco G.;
RT   "Bacterial expressed coat protein for the development of a single antibody
RT   for routine detection of Citrus Tristeza Virus in Portugal";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Bonacalza B., Febres V., Niblett C.L., Nolasco G.;
RT   "Biomolecular characterization of Citrus Tristeza Virus isolates from
RT   Portugal";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Bonacalza B., Nolasco G.;
RT   ;
RL   Submitted (10-SEP-1999) to the EMBL/GenBank/DDBJ databases.
RL   UCTA, Univ Algarve, Campus de Gambelas, Faro 8000, Portugal
XX
DR   SPTREMBL; Q9QEG3; Q9QEG3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="2-93"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QEG3"
FT                   /product="coat protein"
FT                   /protein_id="AAD56569.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYAERP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 122 C; 169 G; 183 T; 0 other;

AF184116  Length: 672  December 21, 2001 14:54  Type: N  Check: 3271  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatgcg gaacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga