Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain 2-98 coat protein gene, complete cds.

ACC No: AF184117

Dated: 1999-09-27 | Length: 672 | CRC: 409456504

                !!NA_SEQUENCE 1.0
ID   AF184117   standard; RNA; VRL; 672 BP.
XX
AC   AF184117;
XX
SV   AF184117.1
XX
DT   27-SEP-1999 (Rel. 61, Created)
DT   27-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain 2-98 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Sequeira Z., Nolasco G.;
RT   "Bacterial expressed coat protein for the development of a single antibody
RT   for routine detection of Citrus Tristeza Virus in Portugal";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Bonacalza B., Febres V., Niblett C.L., Nolasco G.;
RT   "Biomolecular characterization of Citrus Tristeza Virus isolates from
RT   Portugal";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Bonacalza B., Nolasco G.;
RT   ;
RL   Submitted (10-SEP-1999) to the EMBL/GenBank/DDBJ databases.
RL   UCTA, Univ Algarve, Campus de Gambelas, Faro 8000, Portugal
XX
DR   SPTREMBL; Q9QEG2; Q9QEG2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="2-98"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QEG2"
FT                   /product="coat protein"
FT                   /protein_id="AAD56570.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSGDDTTGVT
FT                   YTREGVEVELSGKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRKLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGRTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 123 C; 174 G; 179 T; 0 other;

AF184117  Length: 672  December 21, 2001 14:54  Type: N  Check: 2384  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcgg cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctggcaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaagtt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gccggactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga