Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain 28C coat protein gene, complete cds.

ACC No: AF184118

Dated: 1999-09-27 | Length: 672 | CRC: -2073187240

                !!NA_SEQUENCE 1.0
ID   AF184118   standard; RNA; VRL; 672 BP.
XX
AC   AF184118;
XX
SV   AF184118.1
XX
DT   27-SEP-1999 (Rel. 61, Created)
DT   27-SEP-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Citrus tristeza virus strain 28C coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Sequeira Z., Nolasco G.;
RT   "Bacterial expressed coat protein for the development of a single antibody
RT   for routine detection of Citrus Tristeza Virus in Portugal";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Bonacalza B., Febres V., Niblett C.L., Nolasco G.;
RT   "Biomolecular characterization of Citrus Tristeza Virus isolates from
RT   Portugal";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Febres V., Bonacalza B., Sequeira Z., Niblett C.L., Nolasco G.;
RT   ;
RL   Submitted (10-SEP-1999) to the EMBL/GenBank/DDBJ databases.
RL   UCTA, Univ Algarve, Campus de Gambelas, Faro 8000, Portugal
XX
DR   SPTREMBL; Q9QEG1; Q9QEG1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /strain="28C"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9QEG1"
FT                   /product="coat protein"
FT                   /protein_id="AAD56571.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNVALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 121 C; 177 G; 183 T; 0 other;

AF184118  Length: 672  December 21, 2001 14:54  Type: N  Check: 3989  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg tcgctttgaa cagggatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggaat tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga