Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CPCu IJ-22 coat protein gene, complete cds.

ACC No: AF220504

Dated: 2000-09-15 | Length: 672 | CRC: -662374546

                !!NA_SEQUENCE 1.0
ID   AF220504   standard; RNA; VRL; 672 BP.
XX
AC   AF220504;
XX
SV   AF220504.1
XX
DT   15-SEP-2000 (Rel. 65, Created)
DT   15-SEP-2000 (Rel. 65, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CPCu IJ-22 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Herrera-Isidron L., Juarez-Ayala J.C., Llauguer R., Batista L., Pena I.,
RA   Quinones J., Peral R., Oramas P., Borroto C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular analysis of Citrus tristeza virus isolates from Cuba";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Herrera-Isidron L., Juarez-Ayala J.C., Llauguer R., Batista L., Pena I.,
RA   Quinones J., Peral R., Oramas P., Borroto C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   ;
RL   Submitted (20-DEC-1999) to the EMBL/GenBank/DDBJ databases.
RL   Biotecnologia y Bioquimica, CINVESTAV Unidad Irapuato, Km 9.6, Lib. Norte,
RL   Carr. Irapuato-Leon, Irapuato, GTO 36500, Mexico
XX
DR   SPTREMBL; Q9E7M2; Q9E7M2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="Cuba:Isla de la Juventud"
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CPCu IJ-22"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9E7M2"
FT                   /product="coat protein"
FT                   /protein_id="AAG13183.1"
FT                   /translation="MDDETKKLKNKNKESKEGDNVVAAESSFGSVDLHIDPTLITMNDV
FT                   RHLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSNDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGSHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 124 C; 165 G; 184 T; 0 other;

AF220504  Length: 672  December 21, 2001 14:57  Type: N  Check: 3285  ..

       1  atggacgacg aaacaaagaa attgaaaaac aaaaacaagg aatcgaaaga
      51  aggcgacaat gttgttgctg ctgagtcttc tttcggttcc gtagacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca cttgagtact
     151  caacagaatg ctgctctaaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtaa tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtctcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaaac gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga