Sequence of DPV Citrus tristeza virus

Citrus tristeza virus coat protein gene, complete cds.

ACC No: AF249279

Dated: 2000-06-28 | Length: 774 | CRC: 902930461

                !!NA_SEQUENCE 1.0
ID   AF249279   standard; RNA; VRL; 774 BP.
XX
AC   AF249279;
XX
SV   AF249279.1
XX
DT   28-JUN-2000 (Rel. 64, Created)
DT   28-JUN-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Citrus tristeza virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-774
RA   Park H.-H., Choi T.-J.;
RT   "Sequence Analysis of the Coat Protein Gene of Citrus Tristeza virus
RT   isolated from Cheju Island";
RL   Unpublished.
XX
RN   [2]
RP   1-774
RA   Park H.-H., Choi T.-J.;
RT   ;
RL   Submitted (24-MAR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, Pukyong National University, Daeyun 3Dong, Pusan 608-737,
RL   South Korea
XX
DR   SPTREMBL; Q9IGS1; Q9IGS1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .774
FT                   /country="South Korea"
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IGS1"
FT                   /note="25 kDa"
FT                   /product="coat protein"
FT                   /protein_id="AAF76326.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSSDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHNLCADFLTGAGLADLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 774 BP; 209 A; 141 C; 208 G; 216 T; 0 other;

AF249279  Length: 774  December 21, 2001 14:58  Type: N  Check: 3069  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttgc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagattta ttccttactt tgaaagggaa
     201  gtatcctagt ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtagcg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcata acctgtgtgc agatttcttg accggagctg
     551  gcttggctga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt gatctattgc gttgcgattc tcgatttcta
     701  tcgggatggt ggagtttcat cgtgaacgtg ggtgatataa tcgttcggtt
     751  tgcgttacat gttcctagtg aaga