Sequence of DPV Citrus tristeza virus

Citrus tristeza virus T30, complete genome.

ACC No: AF260651

Dated: 2000-07-18 | Length: 19259 | CRC: 814652162

                !!NA_SEQUENCE 1.0
ID   AF260651   standard; RNA; VRL; 19259 BP.
XX
AC   AF260651;
XX
SV   AF260651.1
XX
DT   17-MAY-2000 (Rel. 63, Created)
DT   18-JUL-2000 (Rel. 64, Last updated, Version 2)
XX
DE   Citrus tristeza virus T30, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19259
RA   Albiach-Marti M.R., Mawassi M., Gowda S., Satynarayana T., Hilf M.E.,
RA   Shanker S., Almira E.C., Vives M.C., Lopez C., Guerri J., Flores R.,
RA   Moreno P., Garnsey S.M., Dawson W.O.;
RT   "Sequences of Citrus tristeza virus separated in time and space are
RT   essentially identical";
RL   J. Virol. 74(15):6856-6865(2000).
XX
RN   [2]
RP   1-19259
RA   Albiach-Marti M.R., Dawson W.O.;
RT   ;
RL   Submitted (26-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Florida, Citrus Reseach and Education
RL   Center, 700 Experiment Road, Lake Alfred FL 33850, USA
XX
DR   SPTREMBL; O10470; O10470.
DR   SPTREMBL; Q9IFW1; Q9IFW1.
DR   SPTREMBL; Q9IFW2; Q9IFW2.
DR   SPTREMBL; Q9IFW3; Q9IFW3.
DR   SPTREMBL; Q9IFW4; Q9IFW4.
DR   SPTREMBL; Q9IFW5; Q9IFW5.
DR   SPTREMBL; Q9IFW6; Q9IFW6.
DR   SPTREMBL; Q9IFW7; Q9IFW7.
DR   SPTREMBL; Q9IFW8; Q9IFW8.
DR   SPTREMBL; Q9IFW9; Q9IFW9.
DR   SPTREMBL; Q9IFX0; Q9IFX0.
DR   SPTREMBL; Q9YN80; Q9YN80.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19259
FT                   /country="USA: florida"
FT                   /db_xref="taxon:12162"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /strain="T30"
FT   5'UTR           1. .108
FT   CDS             109. .9456
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFX0"
FT                   /function="replicase"
FT                   /product="p349 protein"
FT                   /protein_id="AAF70348.1"
FT                   /translation="MSKLGASFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVFDTSGVVRPR
FT                   SVAGAWRYALCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVAK
FT                   LVDPTVRESPQDKTKLKGRRYGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAVPVPIS
FT                   FGTLPTTAWCSEADAAVLRCRLDYHAAATSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRIFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKTLGARVRCLWESSDLDDAKV
FT                   RDGQCYIRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSVPNHHLVGGESAHLFVGQIRLDVRGGVSKPSRSAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSVVGPTLGRIPSVNRKFRLPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGSFTARFPMSASRYEHHYDASMKGAGLSWVRKSQFPNVEVIRRRRSRASGS
FT                   SASFPDANLQVSSDRPSESVQVVPMLDEGSSPPRGVPSPRRNPVEGSGWYSVGSPSRRS
FT                   STTRGQRSAERGKIGDFSFPSGTVYNARVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGR
FT                   LLQLDSYGFSEDLRDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYSVRGYFSAPRLYHCCFTDSPRPFRFLNKYHKMGGEEGALLITDTDRLRAVGSV
FT                   YDKVKKALPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGIHVCRPVY
FT                   DVKDAHRRVVRHHQLGKVAFDHTDGSKQVGAVNTNTVCGNILGECFHASEAIVMVQVYD
FT                   VPLRELCRAMVNKKTSVCYMTMVTPGELLDARESFFIKELDCSVELDVVADRVVYCFNN
FT                   SAYTHAYSTIREYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEVKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKVIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAVSEKCRDLFVGIQEAVERCVRSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEGDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLG
FT                   SDGSDSSLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCVARRLLDLLCERLVG
FT                   SLSRLKFGTTHLTSFFSMLRAKLSCNFFDDSIFTAVWDTVMNLIRIVNGVTKTKLECFR
FT                   NVLRLIPKLCSGCKDFAKDFADMCKSVLLFSTEFFSKSYTKLCRFSLEIFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVILTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTLGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGIIPGVLRIVFSSLFSDADAWVGYSK
FT                   HEVSSLPMITYSAKRLSFVLEQTKEACIAFIVDSSKRILASLTSEIHESLQNSELTSGA
FT                   KSLYGRVSSILSASNGMVNKAGNAVAAVKAAGSGLSKRVKRIRPSFHLTRCVNEQTSEY
FT                   YSASDDSELDESLLSDTPGLRGNGKCNDLFRVVSGRVLVYRRRAVEALKRLVLHVGECL
FT                   YSRIADSFVRLFVRTNTAVGKCESLAVDCATKITDLVVGYITWRNLHFGAYSTTPGLSG
FT                   GSRVSLSRLLDDGLTCVIQNFVTAWLTIFNETFYSSLAHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCIFVWNIIKELSVCIYENLPVCVTRLCNRAFRRSS
FT                   NEDDERTLQVITEAENRIGFLREVLAEMARYRASLEIPVPGSPNSPLFPPTYGEIEELG
FT                   DGSSDSARVIGVDNGSDSMSTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLRFVWRMSRNIFNLRAVKFSYGLALQCIFNGRSTGQFISRLLFSFGGCLPFEFFRHV
FT                   CAVRWLSRSLALHVRNASICDEETVEWLFNFSRFLYDSRYLSLVFSELERVEFYLSYLF
FT                   SLPKRCFTHNRSVQVCVRAPVRVVRDVGLVEDGRKSLSEVLNSLDSLKVSNRKGKSAVI
FT                   ESDSSDSESGSSSGSISFGSINEEVLKTANGSVVSEKASLMKHAAALSGLEPDLGGKKD
FT                   LPIIRRNFTRGESSGTKSVGSLCEYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTAGFDRKLAKMDLDDDVGVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   IKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDLGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSVG
FT                   KSSVSIEVINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPVVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNVTIRDTAPPDSGNLHEPARVRRSKVAGNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9380. .10813
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW9"
FT                   /product="RdRp protein"
FT                   /protein_id="AAF70349.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPECFGRAM
FT                   AAAVIERCFKMDEVAKIRSDIIALTEANIQKWLDKRTPCQVKAVQAELKLPFAVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSQHPAAQNIMFHKKFINAIYSPCFDEFKNRVLSSLNGNIV
FT                   FFTEMTNAGLAEVIRRIIGDDDDLFIGEVDFSKFDKSQDLFIKEYERALYFEFGFDDEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQYKLTDDELFELFTSFKDNTQDFGDQVVLEKLKLLVEIKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERVVYDNRVGYFSYFD
FT                   NTFTKPDASDGQMDDLMTG"
FT   CDS             10862. .11773
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW8"
FT                   /gene="p33"
FT                   /product="p33 protein"
FT                   /protein_id="AAF70350.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKT
FT                   IDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11843. .11998
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O10470"
FT                   /gene="p6"
FT                   /product="p6 protein"
FT                   /protein_id="AAF70351.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12004. .13788
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW7"
FT                   /gene="p65"
FT                   /product="HSP70-like protein"
FT                   /protein_id="AAF70352.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNNLGLNVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPTDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSYYDYTGMPRPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13712. .15319
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW6"
FT                   /gene="p61"
FT                   /product="p61 protein"
FT                   /protein_id="AAF70353.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLNSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLIAPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLKNKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPALFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             15294. .16016
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW5"
FT                   /gene="p27"
FT                   /product="CPm protein"
FT                   /protein_id="AAF70354.1"
FT                   /translation="MAGYTTLPNTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLYTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16116. .16787
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW4"
FT                   /gene="p25"
FT                   /product="CP protein"
FT                   /protein_id="AAF70355.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16753. .17256
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW3"
FT                   /gene="p18"
FT                   /product="p18 protein"
FT                   /protein_id="AAF70356.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDTIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAVTSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             17290. .17649
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW2"
FT                   /gene="p13"
FT                   /product="p13 protein"
FT                   /protein_id="AAF70357.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17725. .18273
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9YN80"
FT                   /gene="p20"
FT                   /product="p20 protein"
FT                   /protein_id="AAF70358.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18356. .18985
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IFW1"
FT                   /gene="p23"
FT                   /product="p23 protein"
FT                   /protein_id="AAF70359.1"
FT                   /translation="MDYTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18986. .19259
XX
SQ   Sequence 19259 BP; 4723 A; 3832 C; 4905 G; 5799 T; 0 other;

AF260651  Length: 19259  December 21, 2001 14:58  Type: N  Check: 2951  ..

       1  aatttcgatt caaattcacc cgtatctccg gagctcgatc cggaccctgc
      51  gggacttggt gtaaatccca accagacggt tgttctacgc ccataatatc
     101  aatacaatat gtcgaaactc ggagctagct tcaagtcctc gactttcgct
     151  gtacgcagcg attacataat ttcgcgcatc tggcgcgcct ttaataccgt
     201  tggagtcctg cacttcttcg gcactgatac aaccactacg gtggttaagg
     251  agttttcggc tgctgggccg atcgtccctt tacggaaatc ctgttttccg
     301  ttctcagttc gcgctgctgt tcgcgcgatt aaagctgccg gacgtcctat
     351  tgacgctccg cgctccggat gcctctgtgg cctccctgtt ttcgacacat
     401  ctggtgtcgt gcgtccccgc tctgttgcgg gcgcttggag gtatgctctg
     451  tgtaaacctc cccttactgc tgccgccaag aagtccattc gcaaggcgaa
     501  gaaagattct gcattctttc tcagccgggc ttcttctctc ttctctcggg
     551  aagtcccttg cggcacgcgt cacagacttc gcaggcgtgt tgcgaaacta
     601  gttgacccta ctgtgcgtga aagtccccaa gacaagacta aacttaaggg
     651  gcgccgatat ggcaaaaatt ctgacctccc gtatatgggg gaagcggcgt
     701  tggatgacat ccttcgctgg attgaggggg taaatcctcc gccgtcgatg
     751  gtcgccgttc cggtgcccat ctcttttggc actctgccca ctacggcttg
     801  gtgctctgag gccgacgccg ctgttctgcg gtgtcgctta gactatcacg
     851  ccgctgcgac ttcctttcgt aatgaaggga agcacgtgag atacgtctat
     901  aatgacgtgt cttccgctgc caaccgtcct cgtacggttt ctccccgcaa
     951  gtgcgggcgt atttttccca gcggttctgc gctgggtgtt gaggttccaa
    1001  gtactaggga ccgccacacc gctttcgtga gatctactca cgctagcgtt
    1051  ttcttttctg acgcggttcg ccgcgttcga atgttccgtc ctgggcggaa
    1101  taatttcttt actagcgtcg tcagtgggcg gcgcgttagt tactttagac
    1151  ccggacctaa cggtacggtg tctgttctaa tgtcggatgg cgtcaatacg
    1201  gcgcgtctcg acgttgtcgc tcccgcgtac tatgcgtacg caaaaacgtt
    1251  gggcgccaga gtgcgctgtt tgtgggagtc gtccgatttg gacgatgcta
    1301  aagtacgtga cggtcaatgc tacattcgtc acgtgtacga cgtggcccta
    1351  tattttggga ggcgcgtcga cctttctgtg cgccgcactt tgggtttatt
    1401  ccccacagtg ggtgcgttaa aggcttatct tgttcgcgag tacggtcgcg
    1451  actctttgaa ggttccgatg cgcgggactt acacttttgg cagtgtattt
    1501  cattgcctgt cgactaaatc ttctgtcgac ttaagatctg ttcctaacca
    1551  tcacttggtt ggtggtgagt ctgctcactt gtttgttggg cagattcgtc
    1601  ttgatgtccg tggtggcgtc tctaagccat cacggtcggc ggttcgcagg
    1651  cgtaatagac gtttgcgtga ggacggtttt ctaggtagta ccgattcatc
    1701  ttcttcagga gggtcgagat actgttcaga ttgttcgact cctcgcagtc
    1751  caccctctcc gtcggttgtt gggccaactc ttggtcggat accgagtgta
    1801  aaccggaaat tccggcttcc agcaggcact cagttgagcg tttctatccc
    1851  taaacgcgat gacgatcgcg tgtacgtgtc ggttggtcaa gactttgatg
    1901  agttgtgcca tgccgtgtgt acctacgtta agaggtacaa ttcgagaaaa
    1951  gcgttttaca cgcgttttga aaacggtgac gattttgctg tcattcggcg
    2001  tgcttccgtc ggaggtcttc acgtgttcgt gaaacgcggt agttttacgg
    2051  ctcgtttccc aatgtcggct tcaaggtatg agcatcatta tgatgcaagt
    2101  atgaaaggcg ccggtttgtc ctgggtgcgg aagagtcaat ttccgaacgt
    2151  tgaagttata cgccgtcgaa ggagccgggc aagcggttct tcggctagtt
    2201  ttccggacgc gaatttacag gttagttcag accgaccgtc ggagtctgtc
    2251  caagtggttc cgatgttgga tgagggttct tcaccacctc gaggagtgcc
    2301  ctcgccccga cgcaatcctg tcgaagggtc gggctggtat agcgtgggtt
    2351  ctcctagtcg gcgctcgagt actactcgtg ggcaacgttc cgctgaacgt
    2401  gggaagattg gggatttcag ttttccgagt ggcactgtgt acaacgcacg
    2451  cgtggacgag cgtgcttata aacgtgtctt aaagttgcgg gacacgtcgg
    2501  catcctcctt tcttcgtata gttctcgctc gtttgtcgag ttatcgacct
    2551  cttagtgacg aattctttaa caaatgcgtt acttctcgat ttgtagcttg
    2601  tatcgaggcg gttgaatcag gtctcgttac agtacacttt cgatcagacg
    2651  tgtttcgtgc ttctttccct tttggtgttt atttatacac tcgtcacgcg
    2701  tttgatattt acagtggtag gctcctgcaa ttagacagct acgggttttc
    2751  agaagaccta agagacggct actgttatat tcgtcacatt gctgaagtgt
    2801  gtttgagtat ggggaaggtt ttctttagga gggacgttaa cttaggggcg
    2851  ttcccttatg ttttcgaggt acagcaccgt cttgagcggt tgtatggtaa
    2901  gcgggctgtt gagtacagcg ttagaggtta tttttcagca ccgcgtcttt
    2951  accattgttg ctttaccgat tcgcctagac ccttcagatt tttaaataag
    3001  tatcataaga tgggtggcga agaaggtgcg ttgttgatta ctgacactga
    3051  cagattgcgt gccgtaggga gtgtttatga taaggttaag aaagctttgc
    3101  ccgattcttt actcgttcga tcagtagaga aagatttgat agaattcaat
    3151  caaactctgg tcgatacgca acgggctaga cccggtgttg cagtgccttt
    3201  tcagatgagt gagaaccaac aggtgatgct cactagagcc tatcctgagt
    3251  ttaatataaa ctttactcat tccgtacact ccgatcatcc cgtggctgcg
    3301  ggctccagaa tgttagagaa tcacctcgtt cgcaaatatg caggcagtga
    3351  ctattcggac gtaggtggtt gcccactatt tcatttgcgt gcaggccaca
    3401  caggaattca cgtttgcaga ccggtgtacg atgttaaaga cgcccaccgt
    3451  agagtcgttc gtcatcatca acttggtaaa gtagccttcg atcatactga
    3501  cgggtctaag caggttggtg ctgtcaatac gaatactgtg tgcggcaaca
    3551  ttttagggga gtgttttcat gcgtctgaag cgattgttat ggtacaggtt
    3601  tacgatgtgc ccctgcgaga gttgtgtaga gctatggtaa acaagaaaac
    3651  ttcggtgtgt tatatgacca tggtcacacc tggcgagttg ttggacgctc
    3701  gtgagtcctt cttcatcaaa gagttggact gttcggtaga gttggacgtt
    3751  gtcgccgata gggttgttta ctgctttaac aattcggcgt acacgcacgc
    3801  gtattctacg atacgcgaat acatgcgtac tccttgtgtg gtggtggatg
    3851  gttttctatt cactatagag atggtttcgc ttagatgcag cgttaattat
    3901  tattgcatca ccaaatcgcg ggtctgtccg agaattagcg aggttaaacg
    3951  actacgctat cgtcggtgtg atagcgactt gattaggatt aagattcctc
    4001  ggtactccag caagactcgt agttgtttac cggggtgtta ttatttgtac
    4051  ttggacgcta agttcgttag tcgcgtgtac gaatacgtag ttaataattg
    4101  tgttgtggtg aatgctaaga cttttgaatg gacttggaac tacatcaagt
    4151  cctgtaagtc gagagtggtc attagtggga aggtcatcca tagagatgtt
    4201  cctatagcgt tggagtattt ggatgggttt tccgcggtta tgttgtccgc
    4251  gggcgtgaaa ggtaggcaga acgcagaagc gttttctagg cgtctggctg
    4301  ccttttcagg agatacttct cttttcgaat tggtgaggtt tgccgtttca
    4351  gagaagtgtc gcgatttatt tgtgggcatt caggaggctg tggagaggtg
    4401  cgtgagatca taccttagga actcgtttaa tatgagtttc gtagacttgt
    4451  cagatccttt gcttactatt agtgagtact cggagttaga tgttcctatc
    4501  gatttgccgg gtttcggctg cataacagaa ggggatgagg ctaaactcat
    4551  agaagatggg gttaagtcgg ctttgctacg aaaagcggtt cgtgacgagg
    4601  cgcaacttat tctcgaaagg ggtggtacgt cggagatcgt tccttgtggg
    4651  gatgatgatg gtttgggcag cgatggttct gacagttcac tcgggtcagg
    4701  tagtgattcg tcctctaaag ctagttctgg tggtttacgt gccggagccg
    4751  ccccttcact gtttagaagc ttactgaaga agttgggcgg gggtttttgt
    4801  gtggccagaa ggttattgga cttgttgtgc gagcgattag ttggttcgtt
    4851  gtcgcgccta aagttcggca ccactcattt aacctcattc tttagcatgt
    4901  tacgcgctaa gctttcgtgt aatttcttcg acgactcgat ttttaccgcc
    4951  gtttgggaca cggtaatgaa cttaattaga atcgttaacg gggtgaccaa
    5001  gacgaagttg gagtgttttc gcaacgtact tcggttaata cctaagttgt
    5051  gttctggttg taaagacttt gcgaaggact ttgcggacat gtgcaagtca
    5101  gttttgctat tttctacgga attcttcagt aaaagctata ctaaactgtg
    5151  tcggtttagt ttggaaatat tcgatgttgg acttattgaa atttcagccc
    5201  gtaatatggg actggagact tgtgtttcga tggcttcagc tatttttgat
    5251  gtcatactta cctatcctct gggaagtatt agctttcccg tcgtttgtgc
    5301  gagagttttt ggcgccctcg ctatggaagt gggatcgaac tattgcttta
    5351  agaaaactct cggcaaaccc gaaattttag gagaggatgc ttttcgtaga
    5401  acggtaagta tggtgttgag cgctaaggct ttcgacaaac tttcagtcga
    5451  tgctaagggt ttagttagat gttccggtat tattcctgga gtattgagga
    5501  tagtgttttc atctctgttt tccgatgctg acgcatgggt gggttatagc
    5551  aagcacgaag tttcctcact tcccatgatc acgtatagtg cgaaaaggtt
    5601  atctttcgtg ttggagcaga ctaaggaagc gtgcatcgct ttcatagtcg
    5651  attcgtctaa gagaatctta gcgtctttga cctcggagat tcacgagtct
    5701  ttgcaaaact cggaacttac tagtggtgct aaatccttgt atggacgtgt
    5751  gagttctata ctctcagcat ccaatggaat ggttaacaag gcaggaaacg
    5801  ccgtcgcagc agttaaggcg gcggggagtg gtcttagtaa acgtgtgaag
    5851  cgcattcgtc cttcctttca ccttactcgg tgtgttaacg aacagaccag
    5901  cgaatactat tctgccagtg acgactctga gttggacgag tcgctgctta
    5951  gtgacacacc cggtcttcgt ggtaacggga agtgtaacga tttatttcgt
    6001  gtcgtttccg ggcgtgtctt agtgtatcgc aggcgcgctg tagaagcctt
    6051  gaagcgttta gtcctacacg tcggtgaatg cttgtactcg cgcattgcgg
    6101  actctttcgt gaggttgttc gtaagaacca atactgcggt cgggaagtgt
    6151  gaatccttgg ctgtcgactg tgccacaaaa attactgatt tagtagtcgg
    6201  atatatcact tggcgtaatc ttcattttgg tgcgtattcg acaactccag
    6251  ggttatctgg cggtagtaga gtttctcttt ccaggctctt ggatgatggt
    6301  ctcacgtgtg taattcaaaa tttcgttacc gcgtggttga cgattttcaa
    6351  tgagaccttt tattcgagtt tggcccatcg gatgaggact gcctcgataa
    6401  atgtgttgtt agagttcctg aagaacctcc cagtttgttt agtttcgata
    6451  tacactttca tagagtgtag atctaggatt tttcctttga aggagtttct
    6501  ttggggcttt tgcattttcg tctggaacat catcaaagaa ctttccgtat
    6551  gtatttacga aaatcttccc gtttgcgtta cgaggttgtg taatagggca
    6601  ttccgtcgta gttccaatga agatgatgag cgcacgcttc aagtaatcac
    6651  tgaagctgaa aaccgaattg ggtttttgcg agaggttctc gccgaaatgg
    6701  cacggtatcg tgcgtctctc gagattcccg tgccggggtc gcctaacagt
    6751  cctttgtttc caccgacata cggtgagatt gaggaactag gtgacggttc
    6801  ttctgatagt gcccgagtga taggtgtgga caacggttca gactcaatgt
    6851  ccactgaagg ggaagcggaa ctagattcgg atggtgatag cgatgattca
    6901  atacctttgg atcgtgactt tgagcagatc ggaggtcttg gaggaagcgg
    6951  caacgtcgac gtctttcgtc tagggttgag gttcgtgtgg agaatgtcgc
    7001  gtaatatatt taacttaaga gccgttaaat tttcttatgg tttagctctt
    7051  cagtgtatat ttaacggcag atcgacgggc cagtttatat cgcgactgtt
    7101  attcagtttc ggcggctgtt taccgtttga gttcttcagg cacgtttgtg
    7151  ctgtgaggtg gttgtcaagg agcttggcat tacacgttcg taacgctagt
    7201  atctgcgacg aagaaacggt tgaatggctt ttcaattttt cgcgattttt
    7251  gtacgattcg cgttatttat ccctcgtgtt ttcggagttg gagagggtcg
    7301  aattttactt aagttacctg ttctcgttgc cgaagaggtg tttcacgcat
    7351  aaccgcagcg ttcaagtttg cgttagagct ccagttcgtg tggttaggga
    7401  cgtgggactt gtagaagatg gtaggaagtc tttatccgaa gtgttgaact
    7451  ctttggactc cttgaaggtg tctaaccgta aagggaagtc agcggttatt
    7501  gaaagtgata gttccgattc tgagagcggt agctcgtccg gttccatctc
    7551  gttcggatcg attaatgagg aagttttaaa aacggcgaac ggtagcgttg
    7601  tatctgaaaa agcttcgttg atgaagcatg cggccgcact aagcgggttg
    7651  gaaccagatc ttggtggtaa gaaagatctt cctattatta ggagaaattt
    7701  cacccgcggt gagtcttcag gtacaaaatc ggtagggagc ttgtgcgagt
    7751  acttgacgac cttaaattcc tcgttcggtt cggtgccgga cttgtatccc
    7801  gtcgcacgtg acataacgta caagaagatg accaacgcca tgcgtgaatt
    7851  ctattattcg caaaaagtaa cgttgtatga acttcatgga aaattaagct
    7901  cgtactggga cgagttaaag acggcgggtt tcgacaggaa attggcgaag
    7951  atggatttgg acgatgacgt tggtgttgtc gattttaact tgaaggtgat
    8001  agtgggaagg catggtactc gtcctttcag aaatactgtg aattctcacg
    8051  agttcatgtt ttgcgacgac ggtttggtgc tttgccctgg tccgaaaaaa
    8101  cgcgatttcg ctttgatttc tagtcaaacg caattcgttg ctgcgaactc
    8151  atttctacgt gccgtggacg gcaaagattt gacgttcact aattcggagc
    8201  atagtcttat agtttatgag gctcctcccg gtggtgggaa gacgcattcc
    8251  ttggtaacgt atttcgccga ttattgtact aaagtgtctt gcctagtggt
    8301  gaccgctaac aagaattcgc aagcggagat ttctcaaagg atctctagag
    8351  agttaatgga tagaaaaatg cttgctaaac atgttattaa aaccgccggt
    8401  agagtgttca ccgtggactc ttatttgatg aaccatattc gacttaagac
    8451  tgacttgttg tttgtcgatg agtgttttat ggttcatgct ggagcaatcg
    8501  gagcagttgt tgaattcact tcatgtaagg ccgtggtttt cttcggtgat
    8551  agtagacaaa ttcattacat tcaccggaac gatcttggtg tttcgttgtt
    8601  acatgacata gacgcattta tagaaccaca gcaccgcatt tacggtgagg
    8651  tgtcttacag gtgtccttgg gacatctgtg agtggttgtc taaattctat
    8701  ccgagacatg tagctactgc taacactgga agtgtcggga aatcgagtgt
    8751  gtctatagag gtaataaatg gatgtgacga tgttccttac gacagtagtg
    8801  cgaagtatat cgtttacaca caagcagaaa agaacgaact gcaaaagcac
    8851  cttggtcgtt taaccgtagg ccgaactaaa gcggtgcctg ttgtgaacac
    8901  agtacatgaa gttcaagggg aaacgtataa gaaggtccgt ttggtaaggt
    8951  gcaaatacca agaggacact cctttctgtt cggataatca tgtcgttgtg
    9001  gccttaacca ggcatgtcga ctccttaact tactctgttt tgaatagtag
    9051  gagatacgac aagactgctt ctagtataga tgaagcgagg gagatttttg
    9101  acaaatttcg ttcgacgaac cattctcacg gttcctcaac gttagaatgg
    9151  tacctcgaaa agtatcctac tgaatataag ggtagcaaag catcttcggc
    9201  accgttaagt tgtattaacg agtttcttaa cgaggtcgtt gtcggttctt
    9251  cggttgtgca gttgggagac acttctgaag aattgagttc tcgccctttt
    9301  gagtccgggt gtgacaatgt taccataagg gacactgctc ccccagactc
    9351  tggtaattta cacgaaccgg ctcgtgttcg gcgtagtaag gtcgcaggca
    9401  attccgccaa gaaaagcgtc cctacaagaa aatcttctgt cgtacgaaag
    9451  tcgtaattac aactttataa agacagagcg gtttgtgggg cctgaatgtt
    9501  ttggcagagc tatggctgcg gctgttattg agaggtgttt taagatggat
    9551  gaagtggcca agataagaag cgatattatt gctttaactg aagccaatat
    9601  tcaaaaatgg ctcgataagc gtactccgtg tcaggtgaaa gccgtgcagg
    9651  ctgaactgaa gttaccgttc gctgtggaag agcaaatcac taactacaaa
    9701  ctaatggtta agcgtgacgc taaagtgaag ctcgatgatt cgagtctgtc
    9751  ccagcatcct gccgcgcaga acattatgtt tcataagaaa tttatcaacg
    9801  ctatttattc tccatgcttc gatgaattta agaatagagt gttatcgtca
    9851  ctgaacggta atatagtttt ctttactgag atgacgaacg ctgggttggc
    9901  ggaagttatc aggaggatta taggcgatga tgacgacctt ttcattgggg
    9951  aagtggattt cagtaagttc gacaagtctc aagatttgtt catcaaggag
   10001  tatgagcgcg cattatactt tgagttcggg tttgatgacg aacttcttga
   10051  cgtgtggatg gaaggcgagt accgcgctag ggctactacg ttagacggtc
   10101  agctgagttt ttcggtcgac ggtcaacgcc gttcgggagg ttcgaacacg
   10151  tggattggga actctttggt taccctaggt atcctatctt tgtactacga
   10201  cgtctcaaag ttcgagctac tactcatttc tggcgacgac tctctgatct
   10251  attcaaaaga aaagattagt aacttttctt cagaaatttg tctggagaca
   10301  ggttttgaaa ctaagtttat gtctcctagc gtaccgtact tttgttcgaa
   10351  gttcgtggta caaactggga acaaaacatg ttttgtgccg gacccttaca
   10401  agctattggt taaactgggg gctcctcagt acaaattaac cgacgatgaa
   10451  cttttcgaac tgttcacttc ttttaaagat aacactcagg actttggtga
   10501  tcaggtggtc ttagagaaat tgaagttgtt agtagagatt aagtacggtt
   10551  ttaccagcgg aactactatg cccgctctgt gtgctataca ttgcgtacgg
   10601  tccaattatt tatcgttcga gaggttgttt ccctttatca ggggttggta
   10651  tgttgtcgat gctttgaagc ttagacaact aaggaagttc gccaatttga
   10701  tctgtgaacg cgtggtttac gataatcgcg tgggttattt ttcgtacttt
   10751  gacaatacgt ttactaaacc cgatgctagc gatggtcaaa tggacgactt
   10801  gatgactggt tgatcgtttg ttcaattctc gctgagagcc aacgttggta
   10851  gttgagtcga gatgtttgct ttcgcgagcg aaaatcaaga cttattagaa
   10901  gaaaagatat ttcgtcgtag aacgtaccat cgtaagtatt tcgatgatgt
   10951  ggttagggat tttactatcg atgttggtta cgatattgtt gatcgtgacc
   11001  ctacggtatt ggctgactat ttctcgttat atttctttct gcttaacaac
   11051  gataacgttg ggcctttagc ggcttcaatt gtggtgagcc cgccggttaa
   11101  cgggacttat aaaattcgag cgcacgtcga taatcaacca aattgcgaag
   11151  gaaacgtgac ttacattaaa actatcgata agagtcgttt tgcgatcctc
   11201  ataaaggcag tcccggctcc tatgagaggt tattactctt ttcgggcgtt
   11251  ccttgccgct gatgtcacta gcgaacgcag tgaattcata tgcagttttg
   11301  tcggtagtag attcctttgt tgttgtacgc aaacgatatc cgaaaatttg
   11351  agtaaggttt gttcgtcttc tttctctttt agagctgtct caaaaaccgc
   11401  aattaacgag ttttctgttg cgattgatga tgtggaagac gttaagtatg
   11451  tgagaaagcg agctgagggt ttctcacatt gcgccgaccc atacccccct
   11501  aggtgttatc gcggcactaa tttaggcgat tcttcagggg ttcaaagtcg
   11551  tacaatcgag gaagaaggtt ataggacaga taccgcaggt aacgtcgcgg
   11601  tctctatccc gaacacccca ctcgttaatg ctgtctctcc gtatgtcgca
   11651  gagtacaacg aaaatacgcg ttcgcgtatc tcgttgatac gccgagtctg
   11701  ttgttacgct gtttgtgttt tagtggtgtc tcttcttata atgagcggtt
   11751  tgttagccat tatattcata tgatttgatg aagtaaatta cgaggtgcaa
   11801  ttagctaaaa ctcaccgttt gactctgttt aaacgggttt caatggactg
   11851  tgtgattcaa ggatttttga cttttctggt tggtatagct gtgttttcgg
   11901  cctttgccgg actgattatc attgttataa cgatttatcg gtgcacgact
   11951  aagcctgtta ggaacacttc tccttacggc actcacgcca ctgtctaagc
   12001  ggtatggtac ttctgggttt agactttggt accacgtttt cgacggtggc
   12051  tatggctaca tcctctgagt tagttatact caaacaatct aattcatcgt
   12101  acatacctac atgtttgttt ttgcatgcag accctaacag cgtgtcttat
   12151  ggttacgatg cggaatattt agcggcttct ggggagcctg gttcttttta
   12201  caaagatttg aaacggtggg ttggttgcac tgcgaagaac taccaaacct
   12251  acttacacaa actatcgcct tcctataagg tgacggtgga agagtttgga
   12301  actaagagtg tgccagtccc atatttgtca cctctgaata acaatttggg
   12351  actcaatgtc gctttacctt tactaatcgc ttcgtatgcc aaatccattt
   12401  tgtcggatgc ggaacgagtg ttcaatgtaa gctgcactgg agttatatgt
   12451  tcggtacccg ctggttataa cacgttgcaa cgagctttta cgcagcagag
   12501  tatatcgatg tcgggttact cttgcgtgta cattattaac gaaccttcag
   12551  cagccgcgta ctccacttta cctaagttga gttcggcaga taaatattta
   12601  gccgtttacg acttcggcgg tgggactttc gacgtctcta tagttagcgt
   12651  cagattgcct acgttcgccg ttaggagttc gggtggtgac atgaatttag
   12701  gtggtagaga tatcgacaaa aagttatctg ataaaatata cgaaatggca
   12751  gattttatac cgcaaaagga attgaacgtt tctagtttaa aggaagcttt
   12801  atctcttcaa actgatccgg tcaaatatac tgtaactcat cacggaatga
   12851  gtgagacgat atcaattgat caaacggcgt tgagggagat agcttcggtg
   12901  ttcataaatc gaacgataga tatacttacg caagttaaag ttaagtctag
   12951  tatgcccgaa tcgcaaagtt taaagttagt ggtagtcggt ggaagctcgt
   13001  acctaccagg attgttggat actttggcaa ccgtgccttt cgtgtctggg
   13051  atagtaccag tggaagacgc aagaaccgcg gtcgctagag ggtgtgcttt
   13101  atatagtgag tgcttagatg gtaggtccaa ggccctacta atagattgta
   13151  ttacacatca tttgtcggtt acgacgttta gcgcggactc ggtcgttgtc
   13201  gcagcggccg gtagtccaat tccttttgaa ggagaacaaa aactcacgtt
   13251  acgcaaatgc gttagcacgt ctaactatca agcaagaatg tttgaaggag
   13301  attacgaaaa ggttttccga aatgaacgta tctacgcagc ttcagtatcg
   13351  ttgtttactt taggagttaa ttggcgtgtg cctaccgacg ttgaaatgac
   13401  tctcgtgacc aaagtggact caatgggtaa agtggaattt taccttaaag
   13451  gtccatctgg tgaactagtc aacgtgcaag gtacttcgta ttacgattat
   13501  actggtatgc ctcgccccac tagaaatttg gtgaagctta gcgattacaa
   13551  tgtaaactcc gccgctttag ttttagcttt gacattaact cgcgaaaaac
   13601  gagaaaagtt tcttttgcgg acattatttg acactttact agcagatttg
   13651  cgaaggacag caagtttgag cgagtactca aagaagtacc cgatcactcg
   13701  aaacgatatc gatgtcgtct catcacgtat ggggatcgtt gtttcgaaag
   13751  ttttacgggg aagcgatttg gaaagaatac ctctctgaat caactcgaag
   13801  ttttgatgaa agaaacgtgt cgttggacca cactttgagt tcgggtgtgg
   13851  tcgtccgtag gcagagtctt ttgaatgcgc ctcaagggac tttcgagaac
   13901  gagttagcgc tattgtataa ttcggtggtg attaacgatt ttgttgagtt
   13951  gactggtatg ccattgaact ctttgatgac aggtatcgag gaccgtaagg
   14001  tgcctgacga attaatatcc gttgacccgc acgaagtcgg atgtagattc
   14051  acgttaaacg acgtggaatc atatctaata agcaggggcg aggattccgc
   14101  tgatgtaacg gcggtcgagc attcgtggtg tttgagtaac tcttgtggta
   14151  gactattaag ttcgaccgag atagatgctt acaaaacctt ggtgtttacc
   14201  aagaatttcg atagtaatgt atctggagtg actactaagt tagagactta
   14251  tctatcgtac tgtatatctt tgtacaagaa acactgcatg aaagacgatg
   14301  attattttaa tcttatcgca cctatgttta attgtttggt gaaagtgctg
   14351  gcgtcacttg gtttgtttta tgagaaacat actgacaatc cgctactgac
   14401  cggaatgctt atagagtttt gcctaaaaaa taaggtgtat tactctactt
   14451  ttaaagtaaa tttagacaac gttagattgt ttaagtctaa agtgttgcct
   14501  gtggtgttaa cagtttggga tatatctgag cctgatgacc cagtggatga
   14551  aagggtgcta attcctttcg atcctactga tttcgtgctc gatttaccta
   14601  aattgaatat acacgacaca atggtggtgg tgggtaatca aatcagacag
   14651  ttagagtacg tagtcgagag cgatgcttta gacgatttat ctcaacacgt
   14701  tgacatacgt ttagcagcgg acaaccccga tctacgcgtt gatctgcgtt
   14751  gggcagggat gtttgtctac tacggtgttt atcggtgtgc tattgataga
   14801  gtggtagaac gaccggcgtt atttagattg ccgcagaagt tattgagtca
   14851  ggatgatggc gaatcgtgct cattgcgcat gagtgccgtc gaagctttat
   14901  ttaatctagt gcaaaaggtg aacagggaca taaacgttag acgtcagttc
   14951  atgggacgtc acagtaaagt ggctttgcga ctgtatcgca acttaggttt
   15001  gaggtttcca ccgatctctt cagttaggtt accggttcat cacggttact
   15051  tatacgtcga tttttacaaa agagtacctg acgatgctgt tactgccgac
   15101  gaactcgaaa gtttacgtca attacgttcg tccgtggacg ttatgtgtaa
   15151  ggacagggtg tcaatcacac ctccaccatt caatcgactt agaagaggtt
   15201  cttctagaac atttagaggt cgaggcgcac gcggtgcgag ctcgcgtcat
   15251  atgagcagag acgtggcaac ttccggtttt aatttacctt atcatggcag
   15301  gttatacaac acttcctaat accgatgaca aagaaatgga tccggtgagt
   15351  gccgctgtac ccggtaagta tccggatgtc attgaaaaat ttgtggccaa
   15401  caggtccgta gacgcgttaa tagaaggcgt cataagtaag ttggatacca
   15451  attcaatata cgaagattcc actgaaaaat ttactggtga acacttgaaa
   15501  tacgttatgg ttactatgga tgctttctta ttagaaaact acaagacgaa
   15551  aacggaagat ctgttggttc acttagctat gatccaaaag aggttgtaca
   15601  ctacatccac gagcactaaa accaagttcc gcgataaagg ttgtattagt
   15651  tacgtgcaag ggggttcgcg atataagtta atggataaag tagtttttcc
   15701  tttcattata tcgaaattta ccgacaggga gactccgaac gctctacgta
   15751  agtatgcttg cactttcgag gagttacact tgtgtatggc taggttgaga
   15801  cccgacttat acgaaaataa aaggacgact aaagccggga ctccacattt
   15851  aaagggctat ttatcagccg actttctttc gggttctctc ccagggtact
   15901  ccgaacatga acgaggcatc attcttcgag cgtctgagtc tatgttagct
   15951  agacgtcaag gttacgagga ggcaaccgag cttcttaacc tacgtgattt
   16001  gggtaagtac ttgtagttgg tttggggacg gtaatattat tattatacca
   16051  tcccttgagc gctgctttaa gggtcgttaa ttgacgactc ttgatatatt
   16101  tactaggttt gaattatgga cgacgaaaca aagaaattga agaacaaaaa
   16151  caaggaaacg aaagaaggcg acgaagttgt tgctgctgag tcttctttcg
   16201  gttccgtaaa cttacacatc gatccgactc tgataacgat gaacgatgtg
   16251  cgtcagttga gtactcaaca gaatgctgct ttgaacaggg acttatttct
   16301  tgctctgaaa gggaagtatc ctaacttgcc tgacaaagat aaggactttc
   16351  acatagctat gatgttatac cgattagcgg ttaagagttc atcattgcaa
   16401  agtgatgatg acaccacggg cataacgtac actcgggagg gtgttgaagt
   16451  agatttgtct gacaaacttt ggaccgacat cgtgtataat tctaagggta
   16501  ttggtaaccg aactaacgcc cttcgagtct ggggtagaac taacgatgct
   16551  ctttacttag ccttttgtag acagaaccgc aatttgagtt atggcggacg
   16601  tccgctagat gcagggattc cggctgggta tcattatttg tgtgcagatt
   16651  tcttgaccgg agctggcttg actgatttag aatgtgctgt gtacatacaa
   16701  gctaaagaac aattgttgaa aaagcgaggg gctgatgagg ttgtagttac
   16751  taatgtcagg cagcttggga aatttaacac acgttgatct attgcgttcc
   16801  gattcccggt ttctatcggg atggtggagt ttcatcgtga acgtgggtga
   16851  tacaattgtc cggttcgcgt tacacgttcc taatgaagat atgctgaata
   16901  gtttttcagc tatatcgaat tgtacgatta tagcggatgg tagtgcttta
   16951  ctaaaggaca atactgtggt tgaccgttta gaaagcatga atcctttggc
   17001  ttatttgtta aaattagcga aaacgactac tactatttgt tttaccatgt
   17051  ccaataaggt tctttttggt actaccaaat ccgaaccact tagttgttta
   17101  gctgtcacgt cggatcgagt tttattcaaa gttattatgg gcgctaacgt
   17151  tgatgattct cggtgcggct gcagtatttg gttttacaac aatggtacgt
   17201  ttcaaaacgg attgacccgt tgtaataatc tcgtcacttt gtttagcgcg
   17251  acttagacac gaagtgaccg ttcggattta attgctgcga tgagtattcg
   17301  acgcgtgtgg ttaaaggtta tagctgtaat tacagtgttg tggtacggta
   17351  aggaaccttc tattagtgaa ggttacaatg ctcttatgaa tgacgacttt
   17401  aaatttatcg atacgcattt ttctaacgtt tcttatgcta agaaatgtta
   17451  cgatttggct aatttcgatt tagacttttt gcgcatcgtt atcattcctt
   17501  tgagtggtgg cacggcgaat gagtcgcgtt ctgatcgcac taacgtttca
   17551  gagattgtcg aatcgcatgt aagcgaccga gacagaatgc acatcttgtt
   17601  gcgtaataag cggatccaga ttccttcgct cttaccttgc gataactaga
   17651  gtctactcag tagtacgtct actagtataa cgtattaaac actttagtga
   17701  ggagttttgt ttgaatcaaa caatatgcga gcttacttta gtgttaacga
   17751  ttacataagc cttttggcta aggttggttc agttgtggaa cgtttgtgcg
   17801  atcccagcgt aactctcacg gaagtgatgg acgaaattaa tgattttaac
   17851  tcgtttctcg ctttggtgca ctctatgaag tcggacatga acggcgatca
   17901  tcaggatggt caccatgaga tgggtgaaca taaatctcgg ttgttgtgca
   17951  atatagaggc gaaactgcga gtgcttctcg acatcataag acgtcggttt
   18001  actcgcgaaa aactgctctg taccagtgct acagacgttg tgggcttctt
   18051  cgtcgtgagg tacatgagtt ctagtcacac tagtttcgaa accgtaatgc
   18101  gaacggaact gaagttggta gttaaagctg tgctgtcgga attgtcccgc
   18151  acgcataaac tagattttag cgagcgagcc tttacggctt acggtatcct
   18201  tttgcagaag ggcaccgtgg caaccgtttg cggtcagttt gacattaatt
   18251  tagtttctcc gtcttgcgtg taggttaata cgcttctcag aacgtatggt
   18301  tgtattaact aactttaatt cgaacatatt tattgtttaa agtctgtgag
   18351  ttacgatgga ttatactagc ggacaaactt tcgtttctgt gaacctttct
   18401  gacgaaagca acacggcaag cactaaagtt gaaaacgtaa aatcggaagc
   18451  ggatcgcttg gagtttttac gtaaaatgaa tccctttatt gttgacgctc
   18501  tggtgcggaa aaccaattat cagggtgctc gctttcgcgc aagaataata
   18551  ggagtgtgcg tggattgtgg tagaaaacac gacaaggcgc tcaagactga
   18601  acgtaagtgt aaggtcaaca acacgcaatc tcagaacgag gtggcgcata
   18651  tgttgatgca cgatcccgtt aagtatttga acaaaagaaa ggctagagcc
   18701  ttttctaacg cagaaatgtt tgcgattgaa ctggtttcgt acaccaagga
   18751  aaggcaattg gcggtcgatt tagccgctga aagggagaag acgagactgg
   18801  ctcgtagaca cccaatgcgt tctccggaag aaactccgga atattataaa
   18851  ttcggtatga ctgctaaggc aatgttaccg gacatcaacg ccgtagacgt
   18901  tggtgataac gaggaaactt cgtcggagta cccagtgagt ctgagtgttt
   18951  ctggcggagt tctccgtgaa caccacttca tctgattgaa gtggacggaa
   19001  taagttcctt gcggaacttt aagtcgggtt ggtaaaaatc ctttatgatg
   19051  gtgatgtatc actagacaat aaccggatgg gtaaagtctt taaaatgatc
   19101  gaggggaaaa ttaaccgtat cctctcgttg gtctaagctc ccacagagtg
   19151  gtagtggtct caagtgaggc ttaacgtatg cgtgaaccaa agaagttctc
   19201  cttagagtgt gtgttgttta cccaacacac tgtccctatg gggggccaac
   19251  ataggtcca