Sequence of DPV Maize necrotic streak virus

Maize necrotic streak virus, complete genome.

ACC No: AF266518

Dated: 2006-06-16 | Length: 4094 | CRC: 397536968

                ID   AF266518; SV 2; linear; genomic RNA; STD; VRL; 4094 BP.
XX
AC   AF266518;
XX
DT   09-OCT-2000 (Rel. 65, Created)
DT   16-JUN-2006 (Rel. 88, Last updated, Version 5)
XX
DE   Maize necrotic streak virus, complete genome.
XX
KW   .
XX
OS   Maize necrotic streak virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   29-3832
RA   Louie R., Redinbaugh M.G., Gordon D.T., Abt J.J., Anderson R.J.;
RT   "Maize Necrotic Streak Virus, a New Maize Virus with Similarity to Species
RT   of the Family Tombusviridae";
RL   Plant Dis. 84:1133-1139(2000).
XX
RN   [2]
RP   1-4094
RX   PUBMED; 16545417.
RA   Scheets K., Redinbaugh M.G.;
RT   "Infectious cDNA transcripts of Maize necrotic streak virus: Infectivity
RT   and translational characteristics";
RL   Virology 350(1):171-183(2006).
XX
RN   [3]
RP   29-3832
RA   Louie R., Redinbaugh M.G., Gordon D.T., Abt J.J., Anderson R.J.;
RT   ;
RL   Submitted (10-MAY-2000) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, USDA, ARS and The Ohio State
RL   University/OARDC, 1680 Madison Ave., Wooster, OH 44691, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-4094
RA   Scheets K.M., Redinbaugh M.G.;
RT   ;
RL   Submitted (20-JAN-2006) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, USDA, ARS and The Ohio State
RL   University/OARDC, 1680 Madison Ave., Wooster, OH 44691, USA
XX
CC   On Jan 20, 2006 this sequence version replaced gi:10644290.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4094
FT                   /organism="Maize necrotic streak virus"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /note="MNeSV"
FT                   /db_xref="taxon:137556"
FT   5'UTR           1. .122
FT   CDS             join(123. .923,927. .2489)
FT                   /codon_start=1
FT                   /product="p92 protein"
FT                   /note="RNA dependent RNA polymerase; replicase;
FT                   read-through protein; similar to Tombusvirus p92 protein"
FT                   /db_xref="GOA:Q9E352"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q9E352"
FT                   /protein_id="AAG21222.1"
FT                   /translation="MELLNKLFGTERPIYVGDFAIGVNKPRNIDMFDLVCRLALKYIRT
FT                   GRVERDVGTLTEFLVVIAKNDCAAKWDWLMRRGKGRDYIKPAIVAGIGILLPLLFAKRW
FT                   YTRMATAVVTLPLTAVATYATLPRESLSAFKMRKEAMADMGDESDATECLEVWKAKSIK
FT                   GPDGEEVVTGSRITRVVAKVKPRRNRYAAKIAQVARSKVGYLSNTPENRLIYQRVLIEI
FT                   MDKDCVRYCDRDALLPVAIGLCFVYQEGVREASQLWGSTESLGLKGGLVRLPGTVTRIN
FT                   NDIPSGVLQSQEVFQVRIGPPVSKERSIYMVSGCPSQARFLVHNHCLANLKRGLVERVF
FT                   CVEKNGKLVRTPQPAKGAFASLSPFRKAVVEEVGTAHRLGYDGFLSYYSGAKLRTYSNA
FT                   VESLHIQSVNERDSHLTTFVKAEKISTSKGDPAPRVIQPRSPRYNVELGRYLRHLESKL
FT                   MKAVDTVYGETTCIKGYTADEVGMIFKNKWDRFHKPVAIGLDASRFDQHCSVEALQFEH
FT                   GFYKALYPNNKLLDKLLSWQLVNKGKGYVPDGGISYVKEGCRMSGDINTSLGNYLLMCS
FT                   MVYGFMRFVGINEYSLANCGDDCVLIVESRNLDQVQSKLPEYFFRLGFTMKVEKPVYYL
FT                   EEIEFCQAHPVQFQGGWKMVRNVRTAMSKDVHCVNNIRDIPTRKAWSNAQHVGGMALSS
FT                   GIPVVETFYSRFRTYDVVKHQRIDTVTNQHKWRGAGGAYVVTPESRASFWQAFRLTGDE
FT                   QQALEDRLMRWEMDLCGIEGTDSCEPSVLDFAAA"
FT   CDS             123. .926
FT                   /codon_start=1
FT                   /product="putative p33 protein"
FT                   /note="similar to Tombusvirus p33 protein"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q9E351"
FT                   /protein_id="AAG21221.1"
FT                   /translation="MELLNKLFGTERPIYVGDFAIGVNKPRNIDMFDLVCRLALKYIRT
FT                   GRVERDVGTLTEFLVVIAKNDCAAKWDWLMRRGKGRDYIKPAIVAGIGILLPLLFAKRW
FT                   YTRMATAVVTLPLTAVATYATLPRESLSAFKMRKEAMADMGDESDATECLEVWKAKSIK
FT                   GPDGEEVVTGSRITRVVAKVKPRRNRYAAKIAQVARSKVGYLSNTPENRLIYQRVLIEI
FT                   MDKDCVRYCDRDALLPVAIGLCFVYQEGVREASQLWGSTESLGLK"
FT   misc_feature    924. .926
FT                   /note="read-through codon"
FT   misc_RNA        2488. .4094
FT                   /note="subgenomic RNA1"
FT   CDS             2520. .3293
FT                   /codon_start=1
FT                   /product="putative capsid protein"
FT                   /note="CP"
FT                   /db_xref="GOA:Q9E350"
FT                   /db_xref="HSSP:P03607"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q9E350"
FT                   /protein_id="AAG21218.1"
FT                   /translation="MTKAKGNDRISRLEVLVERMTAIAPGKTKRKNRKAKPARSSVVTA
FT                   PVVGSAIIRSRVPKVLNSREGVVVSNTERFSILTTAVGVATFSRIDITPSNVLWLNGVA
FT                   INYSKYRWISVQMYYIPIVPTTQTGLMAMGFVYDVNDSMTGTTVGMVQQMYGAVSGPIW
FT                   AGYEGGSGLNTPGTKVPTGALCITLDTGRLDKSYYKYATVAQIGAMSGPEAAMYVPASV
FT                   VWATDSAAVAQGGAGQIMAKYTVELLEPIPATLND"
FT   misc_RNA        3314. .4094
FT                   /note="subgenomic RNA2"
FT   CDS             3329. .3898
FT                   /codon_start=1
FT                   /product="putative p21 protein"
FT                   /note="similar to Tombusvirus p22 protein"
FT                   /db_xref="GOA:Q9E349"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProtKB/TrEMBL:Q9E349"
FT                   /protein_id="AAG21220.2"
FT                   /translation="MDAEYEQVSRPWNELYKEATLGNKLVVNVGSEDAEIPLLPSNYLT
FT                   KARLAMSGGYITMRMIRIRIVPLVSRNSGVSGRLFLRDITDTTGKKLHSTELLDLGKEI
FT                   RLSLRHLDFSVSTRSAVPIVFGFEELVSPYLEGRELFSVSFRWQIGLSAQSYSLPQVPW
FT                   KVLYQEDALRRKLPKKANKTNSPPNV"
FT   CDS             3361. .3873
FT                   /codon_start=1
FT                   /product="putative p19 protein"
FT                   /note="similar to Tombusvirus p19 protein"
FT                   /db_xref="GOA:Q9E348"
FT                   /db_xref="HSSP:P50627"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProtKB/TrEMBL:Q9E348"
FT                   /protein_id="AAG21219.2"
FT                   /translation="MERAIQGSDAWQQTGGQRRVGGCGDSFAPFQLPDESPTSDEWRLH
FT                   HDAYDPDTDCPLGFKEFWSVGKAISKRYHRYDWKEASLDRALGSWQGDKVITEASRFLG
FT                   VDQVSCTYSIRVRGVSITLSGGSRALLRLVSMADRIKRSELQFATSAVESVVSRGCPEE
FT                   ETPKESE"
FT   3'UTR           3874. .4094
XX
SQ   Sequence 4094 BP; 1034 A; 926 C; 1170 G; 964 T; 0 other;

af266518 Length: 4094  16-JUN-2006  Type: N  Check: 8191  ..

       1  agatatcgac ctgcctgacc aggctgagat tgcgctagcc ggcgtagttg
      51  gtatctctcg cgcaagcggg tttgaaggtg cggcctatct taggggggta
     101  aattgtaact tcgcacaaag gcatggagct cctcaacaag ctctttggca
     151  cggagaggcc tatatatgtg ggtgattttg caataggggt caacaaaccg
     201  agaaacatcg atatgtttga cctcgtttgc agactggctc tcaaatatat
     251  taggacggga cgtgtggagc gggacgtggg cacccttacg gaattcctgg
     301  tggtcatcgc gaagaatgac tgtgctgcca agtgggactg gttgatgcgg
     351  cgtggcaaag ggagggatta catcaaacct gccatagtgg caggcattgg
     401  tatcctgctc cctctgctat tcgccaaacg ctggtacact aggatggcaa
     451  cagccgttgt gaccctccca ttaacagctg tggctactta cgccacactg
     501  ccaagggaga gtctgtcagc gttcaagatg cgtaaggagg ccatggcgga
     551  catgggggac gagagtgacg caaccgaatg cttagaggta tggaaggcaa
     601  aatcaatcaa gggacctgat ggtgaggagg tggttacagg cagtcgcatt
     651  actagggtag tagcgaaagt gaaacccaga cgcaaccgct atgccgccaa
     701  gatcgcccaa gtcgctagat ctaaggtagg ttacctcagc aacacacccg
     751  agaacagact tatctatcag agggttctca tagagataat ggacaaggac
     801  tgcgttaggt actgtgacag ggatgccctg ttacctgtag ctatcgggct
     851  ttgtttcgta taccaggaag gtgtgaggga agcgtctcaa ctctggggct
     901  ctacggagtc cctggggttg aaatagggag gcctagtgcg cctgcctggc
     951  actgtgacac gcatcaacaa tgatatccca tccggtgtct tacagagtca
    1001  ggaggtgttt caggtccgca taggacctcc cgtatccaag gagcgcagta
    1051  tatacatggt ttcaggttgt ccatcacagg cgcgcttctt ggttcacaat
    1101  cattgcctgg caaacctgaa aaggggtctt gtggagaggg ttttctgtgt
    1151  cgagaaaaac gggaaactcg ttcgcactcc acaacctgct aaaggagcct
    1201  ttgctagtct ttccccgttc aggaaagcgg tagtggaaga ggtcggaact
    1251  gcccaccgcc ttggttatga cgggtttctg tcatactata gcggcgcgaa
    1301  gttgcgtact tattcgaatg ccgtggagag tttgcatatc caatctgtaa
    1351  acgagagaga tagtcatctg acaactttcg ttaaagcaga gaagatatcg
    1401  actagcaaag gtgacccagc gcctagggtg atccagcctc gatcacctag
    1451  gtacaatgtt gagttggggc gttatctgcg gcatttagag tccaagttga
    1501  tgaaagccgt tgacactgta tatggtgaga ccacgtgcat taaaggatac
    1551  acagccgatg aggttggcat gatcttcaag aacaagtggg acaggtttca
    1601  caagcctgtt gccattggcc ttgacgcctc acggtttgat cagcactgct
    1651  ctgtggaggc cctccagttt gaacatgggt tctacaaggc actttacccc
    1701  aataataagc tcttggacaa attgttgtct tggcagttgg ttaataaagg
    1751  aaaggggtat gtacctgatg gtggaatttc ctatgtaaaa gagggttgtc
    1801  gcatgagtgg ggacatcaat acctctttag gtaattattt gctgatgtgt
    1851  tctatggtgt atgggtttat gagattcgtg ggcatcaacg agtacagcct
    1901  cgccaattgt ggtgatgact gtgtgctaat tgtcgaatct cgtaacttgg
    1951  atcaggttca gtctaaactc ccggaatatt tttttaggct tggtttcacc
    2001  atgaaggtgg agaagcctgt gtattatctc gaggagattg agttttgcca
    2051  agcccaccca gtacagtttc aaggcggttg gaagatggtt cgtaatgtca
    2101  gaacggccat gtctaaggat gtacactgtg tcaacaatat acgtgatata
    2151  ccaacgcgta aggcctggag taatgcacag catgtgggag gcatggccct
    2201  ctcatctggc ataccagtgg tagagacctt ctactcacgc ttcaggacct
    2251  atgatgttgt aaaacaccag agaattgaca cagtcacaaa ccaacataag
    2301  tggcgtggtg ccggtggggc ctatgtggtt acccccgaaa gccgcgcatc
    2351  tttttggcag gcgttccgat taactggaga tgagcaacag gctctggagg
    2401  accgtctaat gagatgggag atggacttat gtggaatcga gggcacagac
    2451  tcgtgtgagc ctagtgtcct agatttcgcc gcagcatgac caacaactcg
    2501  gcacacaaac gcacacaaca tgactaaggc taaaggaaat gacaggatca
    2551  gcagattgga ggtgctcgtg gagaggatga ccgctatagc ccccggcaaa
    2601  accaaacgga agaaccggaa ggccaaaccg gccagatcat ctgtcgtcac
    2651  ggcaccagtt gttggcagcg ccatcattcg cagccgcgtg cccaaggtcc
    2701  tgaacagtag ggaaggcgtc gtggtatcta acacggagag attctccatt
    2751  cttacgacag ccgtcggcgt agcgaccttc tccaggatcg acattacacc
    2801  ctcgaacgtg ctatggctga atggggtggc tattaattac tccaagtacc
    2851  ggtggatatc tgtgcagatg tactacatac ctatcgttcc tacaacacag
    2901  acaggtctca tggcgatggg gttcgtatat gatgtcaatg acagcatgac
    2951  gggcaccacg gtggggatgg ttcaacagat gtatggagcg gtcagtggcc
    3001  ctatttgggc tgggtatgag ggtggatcgg gcttgaacac accaggtact
    3051  aaggttccta ctggtgcttt atgcatcacg ctggatactg ggaggcttga
    3101  taagtcatac tacaagtacg ccactgtagc acaaataggg gccatgtcgg
    3151  ggccagaggc ggcaatgtac gtgccggcaa gcgtggtttg ggcaactgac
    3201  tcagctgctg tcgcacaggg cggcgctggg cagattatgg ccaaatacac
    3251  cgtcgaactg cttgaaccta taccagctac acttaacgac tagtgtgcgc
    3301  ataggggcct cttgaacaag accagttcat ggatgcagaa tacgagcaag
    3351  tcagtaggcc atggaacgag ctatacaagg aagcgacgct tggcaacaaa
    3401  ctggtggtca acgtcgggtc ggaggatgcg gagattcctt tgctcccttc
    3451  caactacctg acgaaagccc gactagcgat gagtggcggt tacatcacga
    3501  tgcgtatgat ccggatacgg attgtcccct tggtttcaag gaattctgga
    3551  gtgtcgggaa ggctatttct aagagatatc acagatacga ctggaaagaa
    3601  gcttcactcg acagagctct tggatcttgg caaggagata aggttatcac
    3651  tgaggcatct cgatttctcg gtgtcgacca ggtcagctgt acctatagta
    3701  ttcgggttcg aggagttagt atcaccctat ctggagggtc gagagctctt
    3751  ctccgtctcg tttcgatggc agatcggatt aagcgctcag agctacagtt
    3801  tgccacaagt gccgtggaaa gtgttgtatc aagaggatgc cctgaggagg
    3851  aaactcccaa agaaagcgaa taagacaaac tctccgccta atgtctgatg
    3901  atgtgaggaa cgtggactgt gatgtggtgg tgcggtacca tggctggtca
    3951  ccatggtaat gcgtagggca acacagttca ttaagactca ctgatgatgg
    4001  cactaggcac ggttcacccc catccttcgg gagggctata gggggtgacc
    4051  gggttacacc accggaagac cggaacattg cctttgggca gccc