Sequence of DPV Pelargonium leaf curl virus

Pelargonium leaf curl virus coat protein gene, complete cds.

ACC No: AF290026

Dated: 2005-04-15 | Length: 1787 | CRC: 1233613215

                !!NA_SEQUENCE 1.0
ID   AF290026   standard; genomic RNA; VRL; 1787 BP.
XX
AC   AF290026; S58174;
XX
SV   AF290026.1
XX
DT   02-OCT-2000 (Rel. 65, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Pelargonium leaf curl virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Pelargonium leaf curl virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1787
RX   MEDLINE; 93228459.
RX   PUBMED; 8470957.
RA   Li Y., Bachmann S., Maiss E., Commandeur U., Breyel E., Timpe U.,
RA   Koenig R.;
RT   "Nucleotide sequence of the coat protein gene of pelargonium leaf curl
RT   virus and comparison of the deduced coat protein amino acid sequence with
RT   those of other tombusviruses";
RL   Arch. Virol. 129(1-4):349-356(1993).
XX
RN   [2]
RP   1-1787
RA   Li Y., Maiss E., Commandeur U., Breyel E., Timpe U., Koenig R.;
RT   ;
RL   Submitted (26-JUL-2000) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenvirologie, Mikrobiologie und biologische Sicherheit,
RL   Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Messeweg 11,
RL   Braunschweig D38104, Germany
XX
CC   On Sep 30, 2000 this sequence version replaced gi:299096.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1787
FT                   /db_xref="taxon:35280"
FT                   /mol_type="genomic RNA"
FT                   /organism="Pelargonium leaf curl virus"
FT   CDS             585. .1754
FT                   /codon_start=1
FT                   /db_xref="GOA:Q86586"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q86586"
FT                   /product="coat protein"
FT                   /protein_id="AAB26100.1"
FT                   /translation="MAMVRRNNNTSIIPVTGMQLATIVGTAVAGAVGNVVKNNGGAIAR
FT                   TAVGFGKQVVKRFRRRKGGGNQQMIQHVGGTGGAIMAPVAVTRQLMGSKPKFTGRMSGS
FT                   VTVTHREYLTQVNNTTAFAVNGGIVDNLLQLNPLNGTLFAWLPAIASNFDQYTFNNVVL
FT                   HYVPLCATTEVGRVAMYFDKDSEDVEPADRVELANYGVLKETAPWAEATLNIPCDRIKR
FT                   YCDDSATVDHKLIDLGQLGIATYGGSGTNAIGDVFISYSVTLYYPQPTNSLLSTRRLDL
FT                   TGASLNGNGPGYIIVSRTPTVISMTFRSTGTFVLTGAYRCLTASTLGLTGNVNVNSITV
FT                   LDTLGLATSFIINCTVSSLPSVVSFTSTGITSATINCVRATRANVVTLA"
XX
SQ   Sequence 1787 BP; 483 A; 391 C; 457 G; 456 T; 0 other;

 AF290026  Length: 1787  April 19, 2005 08:50  Type: N  Check: 7346  ..

       1  gaacgtagaa atctcaagca ggtacagaga actctgcctg agtatttcct
      51  aaatttagga tataccatga aggttgagca acctgtattt caattggaag
     101  aggttgaatt ctgccaggca cacccagtac agtttcaagg tggttggaaa
     151  atggtccgaa atgtccgtac cgctatgagc aaagacgtac actgtgtcaa
     201  taatatacgc gatttggcga cgaggagagc ctggagcaat gcccaacacc
     251  acggggggtt ggcacttagt gccggcatac ctgtggtgga gaccttctac
     301  tctaggttca agctgtatga cacacctcgc aagcatcaac gtattgacac
     351  agtaaccaac gttcataagt ggcgcggatc gggtggaagt tatgttgtga
     401  cccctgagtc tagggctagc ttttgggctg cttttggact caccggggat
     451  gagcaactag cactggagga ccgtttggaa agatgggaga tggatctatt
     501  tggagaggag ggtgttgacg ctcacgagcc cagcatcctt gactccgccg
     551  tagcttgacc aagaacacac aactagagaa gataatggca atggtacgta
     601  gaaataacaa cacatcaatt ataccagtta ctggcatgca gttggcaact
     651  attgttggta ctgcggtagc tggtgctgtc gggaatgtcg tgaagaataa
     701  tggtggggca atagcgagaa cagccgttgg ctttgggaag caagtagtaa
     751  agagatttag aagaagaaaa ggaggaggaa atcagcagat gatacaacat
     801  gtaggtggta caggtggggc cattatggcc ccggtggcag tgactagaca
     851  actcatggga agtaagccta aattcacagg tagaatgtct ggatctgtca
     901  cagtgaccca ccgtgagtac ctaactcagg tcaataacac cactgcgttt
     951  gcggtaaatg gggggattgt cgacaatttg ttacagctca acccgttgaa
    1001  tgggacactg ttcgcatggt taccggctat agcctctaac ttcgaccagt
    1051  acacattcaa taatgttgtg ctacattatg tacctctgtg cgccaccact
    1101  gaggtgggac gtgtggcaat gtactttgat aaggactcgg aagatgttga
    1151  acctgctgat agagttgagt tggctaatta cggagtgctc aaagagacag
    1201  ccccctgggc tgaagcaacc ctgaatatcc cttgtgatcg gattaagaga
    1251  tactgtgatg acagtgctac tgtagatcat aaacttatcg acttgggaca
    1301  gctgggcata gctacatatg gtggctccgg gactaacgct attggagatg
    1351  ttttcatttc ttatagtgtc acgttatatt accctcaacc tacgaactct
    1401  ctccttagta ctaggcgcct tgatcttaca ggtgcttccc tcaatggcaa
    1451  cggacctgga tacattattg tgtcccgaac acccactgtt atcagtatga
    1501  ccttcaggtc tactggcacg tttgtcttaa ccggggcgta tcggtgctta
    1551  actgcatcta ccctcggact tactggcaac gtgaatgtga acagcattac
    1601  ggtattggac acacttggac tagcaactag tttcattatc aattgcacag
    1651  tgtcctcatt accttctgtt gtcagcttca catctaccgg catcacctct
    1701  gccaccataa actgtgttag agctactaga gcaaatgttg ttacactagc
    1751  ataatcttct ctagaggggc ctcttgaaca agaccag