Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine rootstock stem lesion associated virus methyltransferase/helicase polyprotein, RNA-dependent RNA polymerase, p6, HSP70-like protein, HSP90-like protein, coat protein duplicate, coat protein, p19, and p24 genes, complete cds.

ACC No: AF314061

Dated: 2005-04-15 | Length: 16527 | CRC: -1858639638

                !!NA_SEQUENCE 1.0
ID   AF314061   standard; genomic RNA; VRL; 16527 BP.
XX
AC   AF314061;
XX
SV   AF314061.1
XX
DT   07-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Grapevine rootstock stem lesion associated virus methyltransferase/helicase
DE   polyprotein, RNA-dependent RNA polymerase, p6, HSP70-like protein,
DE   HSP90-like protein, coat protein duplicate, coat protein, p19, and p24
DE   genes, complete cds.
XX
KW   .
XX
OS   Grapevine rootstock stem lesion associated virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16527
RA   Zhang Y., Rowhani A.;
RT   "Nucleotide sequence of grapevine rootstock stem lesion associated virus";
RL   Unpublished.
XX
RN   [2]
RP   1-16527
RA   Zhang Y., Rowhani A.;
RT   ;
RL   Submitted (16-OCT-2000) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of California, One Shields Ave., Davis, CA
RL   95616, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16527
FT                   /db_xref="taxon:167634"
FT                   /mol_type="genomic RNA"
FT                   /organism="Grapevine rootstock stem lesion associated
FT                   virus"
FT   CDS             107. .8902
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BEP9"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP9"
FT                   /note="327 kDa"
FT                   /product="methyltransferase/helicase polyprotein"
FT                   /protein_id="AAN63466.1"
FT                   /translation="MSSLAISALPSAVAQLSFGQPAATVAKSFYMTSLPSLQTCFTQCE
FT                   FSSLFICLASFQKIKTFLSFLSSVRELALFSELSTIGFCCEFIRLGVGEHPLFFVSFQC
FT                   GPLSVCLGCVNGIFAVLNISFPFLDVASLLMDVGDVVTPTKVRISKRAKKLNKRAFSIA
FT                   RAAARIRRSKVGNKEVRISHVQPLPAGCLRFSQNKNGTELIIIGRDVGVVARVKTAAPV
FT                   VRRRGGGGRVPLIPLVAVSPFGVRYRCYAPSCGAIACFKNKLASRVAANDSRAEKLLSA
FT                   RRRKLQQQNFNSRVAKKARDVTASRVDMAEGEVTPPRHIFFGSFSEPFPIPSSSGMARS
FT                   VLREEPAIVTCGASAPAIKETPRVSVKKADFSPAAPVPREALTPRVAKRGEAIVISGVV
FT                   HEVLNKIREGVLRFRVGGDMRFSRFFSSTHGCKIVANVRTNTSVWLNCTKVNGEKFSVA
FT                   IPCSVDYVAMLRYVSGGKFPLVLMSRECYPDGLCYMAHMRYLCAFFCQPFRESDYPLGS
FT                   WPSVARLKALVLKRFGDEALNIGVRGYYVSRRAFHCDYDSKYARSLMRLAGYVGGDEVI
FT                   HSTLASTVVLKPGERARDRPKSISFGSFCCELRYVESVNPDAPRLRSEKVLRKVEPRNG
FT                   VRTESADVGSNVTRKRDARIDRKFSHLLAGSVNKVKKRIAAGVLRYRVGGDMDFHNSFL
FT                   TQAGYHLLVRRKTSSSVCVELSTPDGRLLRRDVIPCSRDYAAMLSFAAGGRFPLVLMTR
FT                   DKYKNGYCYLAHCRYASAFLLKGFHPAVFDIGANPTAAKLRSRMVSVLGDRSLSLNLYG
FT                   SFTSRGIFHCDYDAAYVKDLRFMSAIVAGKEEMGEVVASDITPAMKQKTIEAVYDRLYG
FT                   SNDSLLKLSIEKDLIDFKNDVQSLKKDRPVIRVPFYMSEVTQNSLTRFYPQFELKFSHS
FT                   THSDHPAAAASRLLENETLVRLCGHSVSDIGGCPLFHLNSKTQRRVHVCRPVLDGKDAQ
FT                   RRVVRELQYSSVRSGDDEKILEGPSNVDVCHYPLGVCEHESSTMMMVQVYDASLYEICS
FT                   AMIKKKARITYLTMVTPGEFLDGRECVYMESLDCDIEVDVHADVVMYKFGSSCYSHKLS
FT                   IIKDIMTTPYLVLGGFLFSVEMYEIRMGVNYFKITKSEVCPNISCSKLLRYRRANSDVV
FT                   KVKLPRFDKKRRMCLPGYDIIYLDSKFVSRVFDYVVCNCSAVNSKTFEWVWSFIKSSKS
FT                   RVIISGKIIHKDVNLDLKYVESFAAVMLASGVRSRLASEYLAKNLSHFSGDCSFIEATS
FT                   FVLREEIRNMTLNFNECLLQLVKRVAFATLDVSFLDLDATMESITDFAECKVAVDLEEL
FT                   GCLRANAENEKIRNLAGDSMAAKLASEIVVDIEAKPVAKHAEHPKSEVSEKKEHAKPGL
FT                   RGGSKAGVLKEFLDFVLSSASRLFSCVADQQRIKSYVHYLDTAVSFLDQNYENLSFIMR
FT                   VLSKGYSCMFSYLANRGSLANRVASAVQIVREIAVLCANVSVSKAKVVVTFSAAVCAMM
FT                   FNSCGFSGDGREYKSYMHRYTQVLFDTIFFEDSSYLPIELLSSAICGAIVTLFSSGTSV
FT                   SLNAFLLQITKSFSLELIVRNVVRVTHSLSTTATDGVMRSVFSQIISHLLVGNTGNLAY
FT                   QIAFLTGVVPLLVKKCVGLIFSMSEDTYSGFIKHGVSEFSFITNILKYLRGQLVDELKA
FT                   VVQGVFDSNKHLFRDVTQEAIRSTVMQIPTAVVDGLKCAASKVYSGIVGKKTNVGEEKS
FT                   RGGGDDHEEYFSCDESETPGLRGGSRSGFSILFFFSRLVRRARILIGRIKHRCFSKIFE
FT                   SISLKIHELRTFLLGKKRSDVGVYEFLSEDVADALSSIEECDEIENLIGDGFRDMADDS
FT                   LTDMNYFDFSDEFLASVNGLPCAGLRGGGRRVGMLAILNYVYNSLSIMARAASKNSTFT
FT                   SLIIFSRGLVDRIRNIFSNKESVVELVRKYVKNFLKSRMRGLGLRNEHVVNSFGELVPL
FT                   LLRNKLSETFIYRAVPMSKWCWKVCLSAERREKFFALVCLVTLGFPYFARFLGGVVCDK
FT                   LLSSLRRAYDRVIVFLKERCDAAMNGLRCLFHFDGNGDSTSAGLKGGGSQTFLWGLLLR
FT                   LVRFALSLGYAGCKCVFSHHDLFFLCVSLVEEVNMIAKILGCLSFFSRPISSALAFALL
FT                   QPERFVEYSGKLSTTFLFFLKISPRVPLKIKGFFEWVAGSPLLRGVRRFLRLIAVKLNL
FT                   RRKRGLRTRNGGYPSQRAVPVIPSNRVTNDGCERLSEKMQGVEALRSELRILEELDAAV
FT                   VEKLNKRRNREADDSEFSRPMHESTHDVTSFCSKANSVGTALERAVLVEDAVKSEKISR
FT                   MAKDLVRKGTVSDEEITNTLSDDEAIEEVPVSEERDDSPKTVRVSEYLNRLNSSFEFPK
FT                   PIVVDDNKETGGLTNAVREFYYMQELALFEIHSKLCAYYDQLRIVNFERSMAPCNEDAQ
FT                   LYVRKNGSTIVQGKDVRSNIKDFHDHDFLFDGKISVNRRRRSGNVLYHDNLSFLASNLF
FT                   LAGYPFSRSFVFTNSSVDILLYEAPPGGGKTTTLIDSFLKVFKKGEVSTMILTANKSSQ
FT                   VEILKKVEKDISNIECQKRKDKRTPKKSIYTIDAYLMHHRGCDADILFIDECFMVHAGS
FT                   VLACIEFTRCHKVMIFGDSRQIHYIERNELDKCLYGDLDRFVDLQCRVYGNVSYRCPWD
FT                   VCAWLSVVYDNMIATVKGESEGKSSMRINEINSVDDLVPDMGSTYLCMLQSEKLEISKH
FT                   FIRKGLSKLNVLTVHEAQGETYARVNLVRLKFQEDEPFKSIRHITVALSRHTDSLTYNV
FT                   LAARRGDATCDAIQKANELVNKFRVFPTSFGGSVINLDVKKDVEDNSRCKASSAPLSVI
FT                   NDFLSDVNPGTTVIDFGDLSADFSTGPFECGASGIVVRDNISSSNITDHDKQRV"
FT   CDS             <8901. .10280
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BEP8"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP8"
FT                   /note="53 kDa; translated via ribosomal frameshift"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AAN63467.1"
FT                   /translation="SAVRSQAIPRRKPSLQENLYSFEARNYNFSTCDRFTSASMFGEAM
FT                   AMNCIRRCFDLETFSSLRDDVISITRSGIEQWLEKRTPSQIKALMKDIESPLEIDDEIC
FT                   RFKLMVKRDAKVKLDSSCLTKHSPAQNIMFHRKSINAIFSPIFNEVKNRIMSCLKPNIK
FT                   FFTEMTNRDFASVVSNMLGDDDVYHIGEVDFSKYDKSQDAFVKSFEEVMYKELGVDEEL
FT                   LAIWMCGERLSIANTLDGQLSFTIENQRKSGASNTWIGNSLVTLGILSLYYDVRHFEAL
FT                   YVSGDDSLIFSRNKISNYADDICADMGFETKFMSPSVPYFCSKFVVMCGHKTFFVPDPY
FT                   KLFVKLGAVKEDVSMDFLFETFTSFKDLTSDFNDERVIQKLAELVALKYDVQSGNTALA
FT                   LSVIHCLRSNFLSFSKLYPRVKGWQVFYTSVKKALFKSGCSLYESYVTPFGHAVMVWDD
FT                   E"
FT   CDS             10373. .10543
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8BEP7"
FT                   /note="6 kDa"
FT                   /product="p6"
FT                   /protein_id="AAN63468.1"
FT                   /translation="MDQVLQFECLYLLNQAVFAITFVFILLIIRVIKSFRRNVHETPIS
FT                   AVRGQGFSTVV"
FT   CDS             10552. .12351
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BEP6"
FT                   /db_xref="HSSP:1DKG"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP6"
FT                   /note="65 kDa"
FT                   /product="HSP70-like protein"
FT                   /protein_id="AAN63469.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGKVYSFKQNNSAYIPTYLYLFSETN
FT                   HMVFGYEAESLMHNAKVRGSFFRDLKRWVGCDSSNFSDYFDRLKPHYAVRPYKIGTGLN
FT                   DTVIIGNYGGTVRSEVHLPGLIASFIKAMVSCAENAFSCTCTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMVNEPSAAALSACNLINKKSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRTFLTHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGS
FT                   DDKKEDVRVNKSILTTVMLPYVNRTLNILEATLKSYAKNMGGLRSVKCDLVLIGGSSYL
FT                   PGLEDILSKHRRIDRILKVADPRAAVAVGCALYSSCLSGSQGLLLVDCAAHTIAIAGMS
FT                   CDQIICAPAGAPIPFSGTTPLYLPKANRNSQRQIAVFEGEYVKCPRNRKICGSNIKFLD
FT                   IGVTSVSYSPITFYLDVTISSVGAISFVVRGPEGKEVSLTGTPAYNFSSVVLGTRSVRE
FT                   LHISLSNKVHLGLLLHRKADRRLLFSEGEAVRYVETVEVADVLKEFKSYNASSLPPDED
FT                   VEPLMGKSVQKVLRGGRLEEIPL"
FT   CDS             12278. .13882
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP5"
FT                   /note="62 kDa"
FT                   /product="HSP90-like protein"
FT                   /protein_id="AAN63470.1"
FT                   /translation="MSNHSWGSLFKKYYGEADWRKYLSKSIVAHTANIKTLPDVQLYGG
FT                   RTVKKSEFESATPRSFEQELGLLMLSERDVGWCKMCGITVEEAMYQITNPEAYPITAEK
FT                   CDPDVKTEGQKYTMEDVMNFMRRSNLDINDKILAEQCWSLSNSCGVLINPDDKERFVAL
FT                   TFKNNELVNDSSNANIDCRVGDYLVYAMSLFNCRSQKSQAGNISLYEKYCAYIRTYLEN
FT                   TDLYFTSPDRIPLLTGILYDFCKEYNIFYSTYKRNVDNFRFFLTNYMPLISDIFVFQWV
FT                   KPATDVRLLFDISAAELTLEVPTLSLVDSQVVIGHVLRFVESYTADPAIDALEEKLDAI
FT                   MKKSNPHLSTAQLWVGFFCYYGEFRTAQRRVVQRPGVYKTPNSVGGFEINMKNVEEFFD
FT                   KIQREVPNVSLRRQFNGARAHEAFKVFKKGNISFKPISRLNIPREFWYLNVDYFRHANR
FT                   SGLSEEEVLILNNISVDVRKLCAERACSTLPSAKRFSKGHKSSVPSLRQEKNYRDPLIA
FT                   LRNSLYEFRHGNRGRRV"
FT   CDS             13845. .14516
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BEP4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP4"
FT                   /note="25 kDa"
FT                   /product="coat protein duplicate"
FT                   /protein_id="AAN63471.1"
FT                   /translation="MSSGTGIAVGGSEAIETSGFVLSTRKEAVDKFFNELRNENYSSVD
FT                   SSRLSDQEVKEVLEKSKESFKSELASTDEHFVYHIIFFLIRSAIISTSDKVKYVGSHKY
FT                   VVEGKTYTVQDVWVFNMIKGLTKQYKRVNGLRAFCCACEDLYLTVAPAMSERFKTKAIG
FT                   MKGLPVGKEYLGADFLSGTSKLMSDHDRAVSIVAAKNAVDRSAFTGGERKIVSLYDLGR
FT                   N"
FT   CDS             14604. .15200
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BEP3"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProt/TrEMBL:Q8BEP3"
FT                   /note="22 kDa"
FT                   /product="coat protein"
FT                   /protein_id="AAN63472.1"
FT                   /translation="MELMSDDNLSGLVITDASSLNGVDKKLLSAEVIKMLVQKGAPSQG
FT                   IETVFGLLLYALAARTTSPKVQRADSDIIFQNTYGDKTVVVTEGDLKKVLEGCAPLNRF
FT                   TNKLRTFGRTFTEAYVDFCVAYKHKMPQLNAAAELGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
FT   CDS             15200. .15685
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8BEP2"
FT                   /note="19 kDa"
FT                   /product="p19"
FT                   /protein_id="AAN63473.1"
FT                   /translation="MEICAQNPEALVLLRTNQNTTLLVVKSDDEVNLPKLLICGYLRVS
FT                   HRGDVTGCNREDVIKDFEGAHHTVIRSRTVRYDYESAVKEYNNADCVVKFFLETGDVFW
FT                   FFLQSDIKGRAARHLRTFFEANNFFFGSHCGTMEYCLKQVLIETESVIESFCEERNR"
FT   CDS             15687. .16304
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8BEP1"
FT                   /note="24 kDa"
FT                   /product="p24"
FT                   /protein_id="AAN63474.1"
FT                   /translation="MRVIVSPYEAEDILTRSTEMLRNIDSGALDTRECIKAFSTLTRDL
FT                   HCAKASYQWCVDTGLCQRDCAEKRLIDTVESNLRLAHPLIREKVATHFCKDEPKELVAF
FT                   ITRKYVKLTGVAAREAVKIEMRTLSKTVLNKLSLEMAFYMSPRAWKNAEWLDLRYTPLK
FT                   IYRDLLLDVDTLNALCEEDEIHVVVTNKDEDENHDLELQEDC"
XX
SQ   Sequence 16527 BP; 4250 A; 3429 C; 4224 G; 4624 T; 0 other;

AF314061  Length: 16527  April 19, 2005 08:48  Type: N  Check: 9593  ..

       1  gtattctgtt ggctttcacc tgtgtttgtg cctcggttca accacaacct
      51  gaaagtttca gttcccagga gtatcggttt ttcctcagaa accttacttc
     101  ttcagaatgt ctagccttgc tatttctgct cttccctccg cggttgctca
     151  attgagtttt ggtcagcctg ctgccacggt tgccaagtca ttttacatga
     201  cttcccttcc gtcccttcag acttgcttca ctcagtgcga gttttcctct
     251  ctttttattt gtttggcttc tttccaaaaa ataaaaacat ttctttcttt
     301  cctaagttca gtgcgtgaac tcgctctttt ttctgaactg tccacgattg
     351  gattctgctg tgaattcatt cgcttaggtg ttggagaaca tcctttgttt
     401  tttgtttcct tccagtgcgg acctttgtcc gtgtgtttgg ggtgtgtgaa
     451  tggtattttt gccgttctca acatttcttt tcccttttta gacgtcgctt
     501  cgttgttgat ggacgttggt gatgtggtca ctccgaccaa ggtaagaatt
     551  tccaaacgtg cgaagaagtt gaataagcgc gctttttcaa tagcccgtgc
     601  tgctgcgcgt attaggcgtt ccaaggttgg aaataaggag gttcgcatct
     651  ctcatgtgca gcccctccct gctggttgct tacggttttc ccaaaacaaa
     701  aacggaacag aactcatcat aataggtcgg gacgtaggtg ttgtggcgcg
     751  cgtaaaaacc gcagcacctg ttgtgcggcg tcgcggtggc ggcggtcgtg
     801  ttcccctcat acccctagta gccgtttcgc cttttggggt gaggtaccgt
     851  tgttacgcgc cttcatgtgg cgcgatcgcg tgtttcaaga ataagctcgc
     901  tagccgtgtt gccgctaacg atagtcgcgc cgagaagctt ctttcagctc
     951  ggcgccgtaa attgcagcaa caaaatttca acagtcgtgt ggcgaagaaa
    1001  gcgcgtgacg taactgcgtc gcgcgtcgat atggcagaag gtgaagtcac
    1051  accaccgcgc cacatctttt ttggtagttt ttcggaaccc tttccaatac
    1101  cttcttcttc cggaatggcg agatcggtgc ttcgtgaaga acccgctatc
    1151  gttacgtgtg gcgctagcgc gcccgcgata aaagaaactc cgcgggtgag
    1201  tgtgaaaaag gcggattttt caccggcggc gcctgttccg cgggaggctc
    1251  ttaccccaag agtcgctaaa cgcggcgaag cgatcgtcat atcgggcgtg
    1301  gtgcacgaag ttttgaataa gattagagag ggcgttttgc gctttcgcgt
    1351  gggcggtgat atgcgtttct ctaggttctt ctcatcaacc cacggttgca
    1401  aaattgttgc caacgtgcgc accaacactt ccgtgtggtt gaactgcact
    1451  aaggtcaatg gtgaaaaatt ttcggtggcg atcccttgtt cggtggatta
    1501  tgtagcgatg ctgcgttacg tgagtggcgg gaagttcccg cttgtcctga
    1551  tgagcaggga atgttaccct gatgggctat gttacatggc tcacatgagg
    1601  tatctgtgtg ctttcttttg ccaacctttc agagaatcag actatcctct
    1651  gggttcgtgg ccatcggtgg cgcgattgaa ggcgttggtt ttgaagcgct
    1701  ttggtgacga ggcgctgaat ataggcgttc gcggctacta tgtctctcgt
    1751  agggcttttc attgcgacta cgattctaaa tacgcgagaa gcttgatgag
    1801  gcttgcgggg tatgtcgggg gagacgaggt tatacattca acgttggcgt
    1851  ccacggtcgt gttaaaaccg ggtgaacgcg cacgcgatcg tccgaaaagc
    1901  ataagttttg gatcgttttg ctgcgagttg cgttacgtcg aatccgtcaa
    1951  tcctgacgcc cctcgcttgc gaagtgagaa ggttctgagg aaagtggagc
    2001  cgcgcaatgg ggttcgcacg gaaagcgctg acgttggttc gaacgtcaca
    2051  cggaagcgcg acgcccgcat cgatagaaag ttttcgcatc ttttagcggg
    2101  aagtgttaat aaagtgaaga aacgaatcgc ggccggggtg ttgcgatatc
    2151  gagtcggcgg tgacatggac tttcataact cctttcttac ccaagcgggc
    2201  taccacttgc tagtgcggcg taagacgagc agcagtgttt gcgtggaact
    2251  ttcgacgccg gacggtaggc tcttgcgccg cgacgtcata ccctgctcaa
    2301  gagattacgc tgcgatgttg tcgtttgccg caggaggtcg tttcccgttg
    2351  gttttaatga cgagggataa atacaagaac ggttactgtt acttggctca
    2401  ctgtaggtac gcgagcgctt ttcttctgaa gggttttcat cctgcggttt
    2451  ttgacattgg cgctaacccg acggcggcga agcttagatc gcgcatggtt
    2501  tcggtcctag gggacagaag tctgagtttg aatttatacg ggtctttcac
    2551  gtcccgcggt atttttcact gtgattacga cgcggcttat gtgaaagatt
    2601  taagattcat gtcagcgatc gtggctggta aggaggaaat gggagaggtg
    2651  gttgcttctg atataactcc ggcgatgaaa cagaagacta tcgaagctgt
    2701  ttacgatagg ttgtatggta gtaacgattc gttgttgaaa ttgagcatag
    2751  agaaagatct aatagatttc aagaatgacg ttcagagcct gaagaaggat
    2801  agacccgtta ttagggtgcc tttctacatg tctgaagtca ctcagaactc
    2851  gctgacgcgt ttctatcctc aattcgagct taaattctca cactctacgc
    2901  actctgatca tcccgcggcg gccgcttcga ggctgctaga gaacgaaacg
    2951  ttagtgcgat tgtgcggtca cagtgtttcg gacattgggg gttgtcctct
    3001  cttccatctt aactcaaaaa cgcaaaggcg cgttcacgtg tgccgacccg
    3051  tgttagacgg taaagacgcg cagcgtcgag tggtgcgcga attgcagtat
    3101  tcttcagtac gatcgggaga tgatgagaaa attttggaag ggccctccaa
    3151  tgtggacgtg tgtcactacc ctctcggcgt ttgtgagcac gagagtagta
    3201  ccatgatgat ggtgcaggtt tacgatgcat cgctctatga gatatgcagt
    3251  gctatgatta agaagaaggc gcgcataact tacctcacta tggtcactcc
    3301  tggcgagttt ctcgacgggc gtgaatgtgt ttacatggaa tcgctagact
    3351  gcgatattga ggttgatgtg catgcggatg ttgtgatgta taagttcggt
    3401  agttcgtgct attcgcataa gttatcgatc attaaagata ttatgaccac
    3451  gccgtatctt gtgctcgggg gctttttatt tagtgtggag atgtacgaaa
    3501  tccgaatggg cgtgaactac ttcaagatca cgaagtcgga agtgtgcccc
    3551  aatatctcat gttctaagct gctgagatac cgcagggcta acagcgacgt
    3601  cgtgaaagtg aaactgccgc gttttgataa gaagcgtcgc atgtgtttac
    3651  ccgggtacga tattatatac ttagattcaa aatttgtgag tcgtgttttc
    3701  gactacgtgg tgtgtaattg ttccgcggtg aactcaaaga ctttcgaatg
    3751  ggtctggagt ttcattaagt ccagcaaatc gagagtgatt attagtggga
    3801  agatcattca taaagatgtc aaccttgatc tcaagtacgt cgagagtttc
    3851  gctgccgtga tgcttgcgtc gggtgtgcgc agcaggttgg cttcggagta
    3901  tctcgcgaag aatctcagtc atttttcggg agattgctcc tttatcgaag
    3951  cgacctcttt tgttctgcgt gaggagatta gaaatatgac ccttaacttc
    4001  aatgaatgtc ttctgcagtt ggtgaaacgc gtggcatttg cgactttaga
    4051  cgtaagtttc ttagatctgg atgccactat ggaatcaatc acagatttcg
    4101  ccgaatgcaa agtagctgtg gatcttgaag agttgggatg tttgagagcg
    4151  aatgccgaga atgaaaaaat tcggaacctc gctggcgact caatggcagc
    4201  gaaattggct agcgagatag tggtcgacat agaagcgaaa cctgtcgcta
    4251  aacacgcaga acacccgaag agtgaagtga gtgaaaagaa ggagcacgcg
    4301  aaacccggct tgcgtggagg ctcgaaagcc ggagttttga aagagttcct
    4351  cgatttcgtt ctttcgtccg cgtcacgctt gttcagttgc gtggcggatc
    4401  aacaacgaat taagtcgtac gtccattacc ttgacaccgc tgtatcgttc
    4451  ttagatcaga attacgagaa cctctccttc attatgcgcg ttctatcgaa
    4501  aggttactct tgcatgtttt catatctcgc gaatcgtggt agtcttgcca
    4551  atcgcgtggc gagcgcggtg caaatcgtta gagaaattgc tgtgttatgc
    4601  gctaacgtaa gcgtttccaa ggccaaagta gtggtcactt tttccgcagc
    4651  ggtgtgcgcg atgatgttca acagttgcgg cttttcaggc gacggtcgag
    4701  aatataaatc atacatgcac cgttacacgc aagtgttgtt cgacaccatt
    4751  ttctttgaag atagtagcta ccttcccata gagttactca gttccgcaat
    4801  atgcggcgct atcgtcactc ttttctcgtc aggaacttct gtaagtctga
    4851  atgctttcct gctccaaatt accaagagct tctctttgga gcttatcgtc
    4901  cggaacgtgg tgcgcgtgac gcattctttg agcaccacgg cgactgatgg
    4951  agtgatgcgc agcgtcttct ctcaaataat cagtcacctg cttgtgggaa
    5001  acactggtaa cttagcttat caaatagctt ttttaaccgg ggtggtgccc
    5051  ttgttagtga agaaatgcgt gggtttgatt ttttcgatga gcgaggacac
    5101  gtactctggc tttatcaagc atggggttag tgaattttcg ttcatcacta
    5151  atatcttaaa atacctgaga ggacagctgg tagacgaatt gaaagcggta
    5201  gttcaaggag tttttgactc gaataaacat ctctttcgtg atgttactca
    5251  ggaggcgatc cggtcgaccg ttatgcagat accaaccgcc gtggtggatg
    5301  gtttgaaatg tgcggctagt aaagtgtata gcggaatagt cggtaaaaag
    5351  acgaatgttg gggaagaaaa atcccgtggc ggtggagacg accacgaaga
    5401  gtatttttcc tgcgacgaga gcgaaactcc gggtttaagg ggcggatcca
    5451  gaagcggttt ctccatccta tttttctttt caaggttagt gcggcgagcg
    5501  cgcattttga ttggtagaat aaagcatagg tgcttctcaa aaatttttga
    5551  gagtatctcg ttgaagattc atgagcttag aacctttctc cttggaaaga
    5601  agcgaagcga cgtaggggtg tacgaattcc tatccgagga cgtagctgat
    5651  gctctatcct cgatagaaga atgtgacgaa atcgaaaatc tgatcggaga
    5701  cgggtttcgc gatatggcgg atgactctct cacggacatg aactacttcg
    5751  acttctcaga cgaattttta gcctccgtta atggcttacc ttgcgctggg
    5801  ttgcgcggag gcggtaggag ggtgggaatg ctcgccattc tgaattacgt
    5851  ttataactct ctaagcatca tggctagagc agcttcgaaa aattcgactt
    5901  tcacatctct aatcattttt tcgcgcggat tggttgatag aatccgcaac
    5951  attttctcaa ataaggaaag tgtcgttgag cttgtgcgca agtacgttaa
    6001  aaacttttta aaaagtcgca tgcgcggttt gggtctaaga aacgaacatg
    6051  tagtgaattc gttcggggag ttggtgccac tgctcttacg aaacaagttg
    6101  tctgaaactt tcatctatcg tgcggtcccc atgtcgaagt ggtgctggaa
    6151  agtgtgcttg tcagctgagc ggcgggaaaa gtttttcgcg ctcgtgtgct
    6201  tagtcactct gggatttccc tacttcgctc gttttttggg tggggtagtg
    6251  tgcgataagc tcttgtcttc attacgacgt gcgtacgacc gtgtgatagt
    6301  ttttctaaag gagcgatgtg acgcagccat gaatgggttg cgttgtttat
    6351  ttcattttga cgggaatggt gattccacat ctgccggttt aaagggcggt
    6401  ggctcgcaaa cgtttctatg gggcttgtta ttacgtttag tgcgttttgc
    6451  gctatctttg ggctacgcgg gttgtaagtg cgttttctcg caccacgatc
    6501  tatttttctt atgcgtctcc ttagttgaag aggtgaacat gatcgcgaaa
    6551  attctagggt gtttgtcgtt cttctcacga ccaatatcat cagcgctggc
    6601  attcgctctt ttacagcccg agaggttcgt tgagtactct ggaaagttga
    6651  gcacgacttt tttgtttttt ctcaaaattt ctcctcgcgt gcctctcaag
    6701  atcaaagggt ttttcgagtg ggtggccggt agtcctctat tgaggggcgt
    6751  tcggagattc cttcgcttga tcgcggtgaa gctgaacctt cgaaggaaga
    6801  gaggactgag aacgagaaat ggtggttacc ccagccaaag ggccgtgccg
    6851  gttataccat ctaatcgcgt gacaaatgac ggatgtgaga gactgtctga
    6901  gaagatgcaa ggagtcgaag cactacgatc cgaattaagg attcttgaag
    6951  aacttgatgc cgcagtggtg gagaagctca acaaacgcag gaaccgtgaa
    7001  gcggatgata gcgagttctc gcgccctatg cacgagagca cgcatgatgt
    7051  gacttccttt tgttcaaaag cgaattcggt aggcacggcc ctcgaaaggg
    7101  cggtgctcgt ggaagatgcg gtgaaatctg aaaagatctc gaggatggct
    7151  aaagatctgg ttcgtaaggg gactgtttcc gatgaggaaa tcaccaacac
    7201  tttatctgat gatgaagcga ttgaagaagt tccagtctcc gaagagcgcg
    7251  acgactcacc caaaacggta agggtgagtg aatatttgaa tagattgaac
    7301  tcaagcttcg aattcccgaa gccgatcgtg gtggacgaca ataaggagac
    7351  tggagggtta accaacgcgg tacgcgaatt ctactatatg caggagctcg
    7401  ctctatttga aatccacagc aaactgtgcg cttactacga tcagttgcgg
    7451  atcgtgaatt tcgaacgttc tatggcccca tgtaatgagg atgctcagtt
    7501  gtacgttcgt aaaaacggtt ccacaatagt gcagggcaaa gatgtgcgtt
    7551  cgaacatcaa ggattttcac gatcacgatt ttctcttcga tggcaagatc
    7601  tccgtaaata gacgacggcg atctggaaac gttctgtacc atgataacct
    7651  ttcttttctg gcgagcaacc tgtttctggc gggataccct ttttcacgga
    7701  gttttgtttt cactaactct tcggtggata ttcttcttta tgaagctcct
    7751  cccggtggtg gcaagaccac gaccctaata gattccttcc tgaaagtttt
    7801  caaaaagggg gaggtatcca ccatgatact aaccgcgaac aaaagctcgc
    7851  aggttgagat tttaaagaag gttgagaaag atatttccaa tatcgaatgc
    7901  cagaaacgta aagataagag aactccaaag aagagcatat acaccatcga
    7951  cgcgtatttg atgcaccaca gaggttgtga tgctgacata ctttttatcg
    8001  atgagtgctt tatggttcac gccggtagtg tgttggcgtg tattgaattc
    8051  actaggtgcc acaaagttat gatcttcgga gacagtcgac agattcatta
    8101  tattgaaaga aatgaactcg acaagtgcct ttacggagac cttgacaggt
    8151  tcgtagacct gcaatgtcgt gtctacggta acgtgtcgta ccgctgtcca
    8201  tgggacgtct gcgcctggtt aagcgttgtt tatgacaaca tgatcgccac
    8251  cgttaagggt gaaagcgaag gaaaaagtag catgcgcatt aacgaaatca
    8301  actcggtgga cgacttagtc cccgatatgg gttctactta cttgtgcatg
    8351  cttcagtctg agaagttaga aatcagtaag catttcatcc gcaaagggct
    8401  ctctaaactt aatgtcttga ccgtgcacga ggctcaaggt gagacatacg
    8451  cgcgcgtgaa tctggtgaga ttgaaatttc aggaggacga gccttttaaa
    8501  tccatcaggc atataaccgt cgcattatct agacacaccg acagcttgac
    8551  ttacaacgtc ctagccgctc ggagaggcga cgccacgtgc gacgctatac
    8601  aaaaagctaa cgagttggtg aacaagtttc gtgtcttccc gacttctttc
    8651  ggtggtagcg ttatcaatct cgacgttaag aaagatgtgg aggacaacag
    8701  taggtgcaaa gcttcttcag cgcctttaag tgtgatcaac gacttcttga
    8751  gcgacgttaa tcccggcacc accgtaattg atttcggaga tctctctgca
    8801  gattttagca cgggaccttt cgagtgtggc gctagcggca tcgtcgtgcg
    8851  agacaacatc tcctccagca acatcactga tcacgataag cagcgtgttt
    8901  agcgcagtgc ggtcgcaggc gattccgcgc agaaagcctt ccctgcaaga
    8951  gaatctttat tcttttgaag cgcggaatta caacttctcg acttgcgacc
    9001  gctttacctc agcttctatg ttcggtgaag ctatggctat gaactgcata
    9051  cgccgctgtt ttgatttaga gaccttttca tctttgcgcg atgatgtgat
    9101  ttctatcaca aggtcgggta ttgagcagtg gttggagaag cgtactccca
    9151  gtcaaataaa ggctttgatg aaagatatcg aatcaccgct ggaaattgat
    9201  gatgagatct gcaggttcaa attgatggtg aagcgtgatg ctaaggtgaa
    9251  gttagattct tcttgcctaa ccaaacacag ccctgctcag aacattatgt
    9301  ttcatcgtaa aagtatcaac gcgatttttt cacccatttt taacgaagtg
    9351  aagaaccgta tcatgagctg tcttaagccc aacataaaat tcttcaccga
    9401  gatgactaat agggatttcg cttccgttgt gagcaacatg ctcggtgatg
    9451  acgatgttta ccatataggc gaagtcgatt tctcgaagta tgacaagtct
    9501  caggatgctt tcgtgaaatc ctttgaagaa gtcatgtaca aagaactcgg
    9551  ggttgacgag gaactcttag cgatttggat gtgtggtgaa aggctttcca
    9601  ttgcgaatac gcttgacggt cagctgtctt tcacgattga gaaccagaga
    9651  aagtcgggtg cctcaaacac gtggatcggt aattctcttg ttacgctggg
    9701  catactaagt ctctattatg acgtgaggca ttttgaggct ctctacgtct
    9751  ctggtgacga ctctctgatt ttttcacgca acaaaatttc gaattacgct
    9801  gatgatatct gcgctgatat gggtttcgaa acgaagttta tgtctccgag
    9851  tgttccgtat ttttgttcca aattcgtcgt tatgtgcgga cacaagacct
    9901  tttttgtgcc tgatccgtat aagttattcg tgaaactggg agctgtaaag
    9951  gaggatgtct ctatggattt tctctttgaa actttcacct cctttaagga
   10001  tttgacttcg gattttaacg atgagcgcgt gattcagaaa ctcgctgagc
   10051  ttgttgctct caaatacgac gttcagagtg gtaataccgc tctagcgttg
   10101  agcgtgatac attgtttgcg ttctaacttt ctatcgttca gcaaactgta
   10151  ccctcgtgtg aaaggatggc aggtttttta cacctccgtt aagaaagcac
   10201  tttttaagag cgggtgctca ctctacgaaa gctacgtcac tccattcggt
   10251  catgcagtga tggtgtggga tgatgagtag cacgctactc ttgcgtagtt
   10301  ttgaacggta ctgtttccgc gactgtggga tgatcacgtg acatacacga
   10351  tgtgtgtcac tgtatagata ttatggacca ggttctgcag ttcgagtgtc
   10401  tgtatctgct caaccaggcg gtttttgcaa taacattcgt cttcattctg
   10451  ctcatcattc gcgtgattaa atctttccgc agaaacgtac acgaaactcc
   10501  aatatcggcc gtccgtggtc agggtttctc gactgttgtg tgatttgcga
   10551  aatggttgtt tttggtttag atttcggtac gactttttcg acggtctgcg
   10601  tgtataaaga tggtaaggtt tactcattca aacaaaacaa ttctgcgtac
   10651  attccgacat acctctacct tttctccgaa actaatcaca tggtttttgg
   10701  ttatgaagcc gaatcactga tgcataatgc aaaggtgaga ggctctttct
   10751  ttagggactt aaaacgctgg gtgggttgcg actccagcaa ctttagtgac
   10801  tactttgatc gcctgaagcc acactatgcg gttcgcccgt ataaaatagg
   10851  tactggtctg aatgatacgg tgattatagg aaactacggg ggtaccgttc
   10901  gttccgaagt gcatttgcca ggactaatag cttcctttat caaggcgatg
   10951  gttagttgtg ccgagaatgc tttttcttgc acttgcacgg gagtgatatg
   11001  ttcagtgcca gcgaattatg acagtgttca gaggaatttc actgatcagt
   11051  gcgtttcctt gagtggttat caatgtgtgt acatggtcaa cgaaccttcc
   11101  gcggctgctt tatcagcgtg caatctgata aacaagaagt cggcgaactt
   11151  ggctgtatac gattttggag gtgggacttt cgacgtgtct attatttcct
   11201  accgcaacaa tacattcgta gtgcgcgctt ctggaggaga tttaaatttg
   11251  ggaggaaggg atgttgacag aacctttctg actcatcttt tttctctaac
   11301  atccttagaa cccgatcttt cgttagacat ttcaaatcta aaagagtcgt
   11351  tgtctaaaac tgacgcggaa atagtttaca cgctaaaagg gagcgacgat
   11401  aaaaaggagg atgttagagt gaataaaagt attctcacta ctgttatgct
   11451  cccttacgtc aatagaactt taaatatttt ggaagcaaca cttaaatcgt
   11501  acgccaaaaa tatgggtggg ttacggagcg ttaaatgcga cttagtgcta
   11551  atcggtggtt cttcgtatct tccgggttta gaagatatct tatcgaaaca
   11601  ccgacgaatc gatcgaatat tgaaagtcgc tgatccccga gcggcggtcg
   11651  cggtcggttg tgcgctatat tcgtcgtgcc tttcaggttc acaagggctg
   11701  ttattagtcg attgcgcggc tcacaccatc gcaatagccg gtatgagctg
   11751  tgaccagatt atttgcgctc cagctggagc tcctattccc ttctcgggga
   11801  ccacaccgtt gtacttacca aaagctaata gaaattcaca acgtcaaatc
   11851  gcagtattcg aaggtgaata cgtgaagtgt cccagaaata gaaaaatttg
   11901  cggttcaaac attaaatttc ttgatatcgg tgtcacaagc gtttcatact
   11951  cacccatcac tttctattta gacgtaacca tatctagtgt gggggctatc
   12001  tcgtttgtgg tgagaggtcc cgaaggaaag gaagtttcct tgacgggcac
   12051  tcccgcttac aacttttctt ctgtagtcct cggaacacgt agtgtccgag
   12101  agttgcatat tagtctaagc aataaagttc atctcggcct acttctacac
   12151  cggaaggctg accggcggtt actattttcc gaaggtgaag cggttcgcta
   12201  cgtggaaaca gtagaagttg cggatgtgct aaaagaattt aagagctaca
   12251  acgctagttc tctaccacca gacgaagatg tcgaaccact catggggaag
   12301  tctgttcaaa aagtactacg gggaggcaga ttggaggaaa tacctctcta
   12351  agagcattgt agcccacaca gctaacataa aaactttgcc ggacgttcag
   12401  ttgtacggcg gtagaactgt gaagaagtcc gaatttgaat cggcgactcc
   12451  gaggtcgttc gagcaggaat taggacttct gatgttaagt gaacgggacg
   12501  tgggttggtg taagatgtgc gggataactg tggaggaggc aatgtaccaa
   12551  atcacgaacc ctgaagcgta tccgatcaca gcggaaaaat gcgatccaga
   12601  tgtgaaaact gaggggcaga aatacacgat ggaagacgtg atgaatttca
   12651  tgcgtcgttc caacctagat ataaatgata aaatcttagc ggaacagtgt
   12701  tggtctctat ccaattcgtg cggagttttg attaaccccg atgataaaga
   12751  acggtttgtt gctctcactt ttaagaataa cgaattggtt aacgattcaa
   12801  gcaacgcgaa catagactgt cgcgtgggtg attacttagt ttacgctatg
   12851  tccctattca attgtaggag tcagaagtcg caagcgggta acatttcgct
   12901  ctacgaaaag tattgcgctt acatcagaac ttacttagaa aataccgatt
   12951  tatatttcac ttctcccgat aggataccgt tactcaccgg cattctctat
   13001  gatttctgca aagagtataa tatcttttat tccacataca aacgaaacgt
   13051  tgataatttc aggttcttcc taacgaatta tatgcccttg atttcagaca
   13101  tattcgtttt ccagtgggta aaaccggcaa cggacgtgag attactattc
   13151  gatataagcg cagccgaatt gactttagaa gttccaacgt taagcttagt
   13201  ggattcgcag gtggtgatag gacatgtcct gagatttgtc gaatcataca
   13251  ctgctgatcc ggctattgac gcgttggaag agaaattgga cgctataatg
   13301  aagaagagta atcctcatct atctacggcg caactgtggg taggattctt
   13351  ctgctattac ggcgaatttc gcaccgcaca acgtcgggtg gtgcaaaggc
   13401  cgggtgtgta taagacgccc aattcggtcg gaggtttcga gattaatatg
   13451  aaaaacgtcg aagagttttt tgataagatc caacgagagg tgccaaacgt
   13501  gtctctacgg cgacaattca acggagccag agcgcacgag gcgttcaaag
   13551  tatttaaaaa gggaaacatc agcttcaaac ccatatctcg gttaaacata
   13601  ccgagggagt tctggtatct gaatgtggat tattttagac atgcgaacag
   13651  aagcggactg agcgaagagg aggtgctcat tcttaataat ataagcgtag
   13701  atgttcgtaa attgtgtgcg gaaagagcgt gcagcactct gcctagcgcg
   13751  aagcgcttta gcaaaggtca taaaagtagt gtgccatcat tgcgtcaaga
   13801  gaaaaattat agagatccgt tgatcgcgtt aagaaactct ttatatgagt
   13851  tccggcacgg gaatcgcggt aggagggtct gaggccatcg agacctcagg
   13901  tttcgtgcta tctacgcgaa aggaagccgt cgataagttc ttcaatgaac
   13951  taaggaacga aaattattct tcggtcgaca gcagtcggtt aagcgaccaa
   14001  gaggtgaaag aagttctgga gaaaagtaaa gagagcttta aaagcgaatt
   14051  agcgtccacc gacgaacact tcgtttatca catcatcttc tttctgattc
   14101  gaagcgccat tatatccacg agcgataagg taaaatacgt agggagccat
   14151  aagtacgtgg tcgaaggaaa gacgtacaca gttcaagacg tttgggtttt
   14201  taacatgatt aaggggctga ccaagcagta caaaagggtg aatggtttgc
   14251  gtgctttctg ttgtgcctgt gaagatttgt atctgacagt tgctcccgcg
   14301  atgtctgaac gcttcaaaac caaggctatc ggtatgaagg gcctacccgt
   14351  cggaaaggag tacttaggtg ctgactttct ctctggaacg agtaaattga
   14401  tgagtgatca cgatagagct gtatccatag tcgcggccaa gaacgctgtc
   14451  gatcgtagcg catttaccgg tggagagagg aagatagtta gtttgtatga
   14501  cttaggaagg aactaagcac gttgtgctat agtgcgtgtc ataatattaa
   14551  gtactagtgc atattaacaa gcagtagtgt ttaaagcgta gtgataagaa
   14601  acaatggagt tgatgtccga tgataacttg agcggtctcg tcataaccga
   14651  cgcttctagt ttgaatggtg tcgataagaa actgctgtct gcggaggtca
   14701  taaaaatgct tgtgcagaag ggggcgccca gccaaggtat tgaaacagtc
   14751  tttgggctac tgctctacgc tctcgcagcg agaaccacat cgcccaaagt
   14801  tcagagggct gattctgata taatctttca aaacacttac ggtgacaaga
   14851  ctgttgtcgt gacagaaggt gatctcaaga aagtgcttga agggtgcgca
   14901  cctcttaata gattcactaa caagctgcga actttcggcc gcacgtttac
   14951  ggaggcgtat gttgatttct gcgtggctta caagcataag atgcctcagc
   15001  tcaacgcggc cgcagaattg gggataccag cagaagattc gtacctagct
   15051  gcggactttt taggtgcttg cccgaaactc tctgaattac aacaaagtag
   15101  aaaaatgttt gcaagtatgt acgctttgaa gactgagggc ggagtagtaa
   15151  atacgcccgt tagtaatttg cgccaattag gtaggagaga agttatgtga
   15201  tggaaatttg cgctcagaat cctgaggcac tagtgctatt acgcacaaat
   15251  caaaacacaa cattactagt cgtcaagtct gatgatgaag ttaatctgcc
   15301  gaaattgtta atatgcgggt atttacgcgt gtcgcatcgc ggggatgtga
   15351  ctggttgtaa tcgcgaagac gtaataaagg attttgaagg tgcacatcac
   15401  accgtcatcc gctcgagaac ggtccggtat gattacgagt ccgcagttaa
   15451  agagtacaat aacgctgatt gcgtggtgaa attcttttta gaaacaggag
   15501  acgttttttg gttttttctc caaagtgaca tcaaaggaag agcggcgcga
   15551  cacttgcgca ccttcttcga agctaacaat ttcttctttg gatcgcattg
   15601  cggtaccatg gagtattgtt tgaagcaggt actgatagaa actgagtctg
   15651  taatcgaatc tttttgtgaa gaaagaaatc gttaagatga gggtgatagt
   15701  atctccttat gaagctgaag acattctaac aagatcaact gaaatgttgc
   15751  gaaacataga cagtggagcg ttggatacga gagagtgcat taaagcgttc
   15801  tcgacgctaa cgcgagattt gcactgcgca aaagcatcgt accaatggtg
   15851  cgttgacaca gggttgtgcc aacgtgattg cgccgaaaaa cgcttgatcg
   15901  acaccgttga atcaaatctg agactcgctc accctctcat acgcgagaag
   15951  gtggcgactc atttttgcaa agatgaaccc aaagaactag tggcgttcat
   16001  cacgcggaaa tacgttaagc tcacaggtgt ggcggcgcgg gaggctgtaa
   16051  aaatagaaat gcgcactcta tctaagacag ttttaaataa actatcttta
   16101  gaaatggcct tctatatgtc acctcgagcg tggaaaaacg cagaatggtt
   16151  agatctcagg tatacgcctc taaaaatata cagagatctt ttactagacg
   16201  tggacacact caacgcctta tgcgaggagg atgaaattca cgtcgtcgtg
   16251  accaataaag atgaagacga gaatcatgat ctcgagcttc aagaagactg
   16301  ttaaagtcta aaattctaga atcgcaatat gtttgcgagt agtaaataaa
   16351  atcgaacgtg ggtggatcta cctgacgtat caactttagc tgttactggg
   16401  taattaagct aacaagtgtt agcgtaatgt gtatgttgat gaagagaaaa
   16451  taccgtttct agatcggtga cttttctctt cttttatttt taaaataaaa
   16501  ataaaaaaaa aaaaaaagaa gcgagct