Sequence of DPV Gremmeniella abietina RNA virus L1

Gremmeniella abietina RNA virus L1 putative coat protein and putative RNA dependent RNA polymerase genes, complete cds.

ACC No: AF337175

Dated: 2003-12-04 | Length: 5133 | CRC: -838012630

                !!NA_SEQUENCE 1.0
ID   AF337175   standard; genomic RNA; VRL; 5133 BP.
XX
AC   AF337175;
XX
SV   AF337175.1
XX
DT   22-FEB-2001 (Rel. 66, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Gremmeniella abietina RNA virus L1 putative coat protein and putative RNA
DE   dependent RNA polymerase genes, complete cds.
XX
KW   .
XX
OS   Gremmeniella abietina RNA virus L1
OC   Viruses; dsRNA viruses; Totiviridae.
XX
RN   [1]
RP   1-5133
RX   PUBMED; 14648287.
RA   Tuomivirta T.T., Hantula J.;
RT   "Two unrelated double-stranded RNA molecule patterns in Gremmeniella
RT   abietina type A code for putative viruses of the families Totiviridae and
RT   Partitiviridae";
RL   Arch. Virol. 148(12):2293-2305(2003).
XX
RN   [2]
RP   1-5133
RA   Tuomivirta T.T., Hantula J.I.;
RT   ;
RL   Submitted (16-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Finnish Forest Research Institute, Vantaa Research Centre, Jokiniemenkuja
RL   1, P.O.B. 18, Vantaa 01301, Finland
XX
DR   GOA; Q99AT3.
DR   GOA; Q99AT4.
DR   SPTREMBL; Q99AT3; Q99AT3.
DR   SPTREMBL; Q99AT4; Q99AT4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5133
FT                   /db_xref="taxon:152217"
FT                   /mol_type="genomic RNA"
FT                   /organism="Gremmeniella abietina RNA virus L1"
FT                   /serotype="type A, HR2"
FT                   /specific_host="Gremmeniella abietina"
FT   CDS             276. .2606
FT                   /codon_start=1
FT                   /db_xref="GOA:Q99AT4"
FT                   /db_xref="SPTREMBL:Q99AT4"
FT                   /product="putative coat protein"
FT                   /protein_id="AAK11655.1"
FT                   /translation="MANAYETNFQTANASPLTGTLADPVGGTIQADHYRRYRAGVFMSV
FT                   PDMGHVSNVGRSIFYEVGRHHGRARDLLAAPHAEAIPIDCSVDINAAEAANFEGMARRF
FT                   SNFSPQWVKMDLAGMVERLAKGVTAAGVFGGIDTGTLRGGQAIRVTALGTLDSPQTASI
FT                   NSVFIPRTVDTVGNDHVFAVLVSAANGEGAAVTTDVVRLDANTNQPMIPAVAGASFATA
FT                   CVEALRILGANMEASGAGDVFAYAVTRGVHAGVSVVAHTDEGGWFRNVLRHDRFRVPYG
FT                   GINQGLRQYPALPALASTSPSSIAAWADAIALKTAAAVAHCDPLVPGEGGWYPSVFTAG
FT                   QNGTSAPGSSESAEVGDQEARSIGRQIASDIGRFAPAYCRALGTLFGLHTSSGVAESHL
FT                   STVAMRALTQDVNTDRHLRHETVAPYFWIEPTSLIAVNAFGTPAEAEGYGSKVTPGDTR
FT                   SEPCFERFRLLQKGSTANHMTVAFKMRTARTSALVSAYAAAPAPLADLKLYQFDESSVV
FT                   LPGDQLPTQGDVAHKHAAADPLSSYLWKRGQSCFPAPAEFINTNSNYGAKVRLVTWDDD
FT                   FNASLSDLPNDEEMATGVVTFRVTVPTGLASAGSNAENREAKRARTRGAIALAQAVLRA
FT                   RATGLAVSPSMEISDVPPTFDTPPLLPAPTYSDTQSASGPRDPGPVPVLAVGGGLDVGR
FT                   VARGAPLPPTAHHMPQRAPRIAGAVVPPGGPVAGPPAATGGPAAPNVPPPPPAGPLDSQ
FT                   DPLPAPPAHLPAEATAAEAVPAQ"
FT   CDS             2603. .5080
FT                   /codon_start=1
FT                   /db_xref="GOA:Q99AT3"
FT                   /db_xref="SPTREMBL:Q99AT3"
FT                   /function="dsRNA replication"
FT                   /product="putative RNA dependent RNA polymerase"
FT                   /protein_id="AAK11656.1"
FT                   /translation="MIESPVSVRANEAGIVGQYLKGLLNMEWASGVMVLSFSQQISEVY
FT                   KPTFNGLRPTDLQRAAAAYLVPDFPVQVRIERGSVLSLLSQVIDPPARVTDRCSFRWLC
FT                   DPKASYAAFPPKQHPGAMNKVNVYLNEVASSLLSLDPAAYSSASQALWPHKGKIANDQA
FT                   SAIILYGYGLRAQAVPDAMHVAATLATTPDLAKALTNFLKATGANGSRLGALLCESNVL
FT                   LGRAAGPADLSEEARYRTSSDVESHLAIFSDADLGAAIDAILDEEIKRVEGSQHIEFDS
FT                   YQEHWNDRWAWAVNGAHSGHVSRLYPRVPKPPGMLREHRRAWLESVTEDPRTDWDGKTF
FT                   VSASPKLEAGKTRAIFACDTVNYLAFEHLLAPVEKRWRNSKVILDPGRGGHLGMIFRTT
FT                   AARARAGVSMMLDYDDFNSHHSTRAMQMLFQRLGDRVGYPADKLAKLVASFEKMYIYNG
FT                   MEQVGRVKGTLMSGHRGTTFINSVLNKAYLLIVLGEDLFERSVALHVGDDVYFGVRTYA
FT                   EAGEVVTRIKNSPLRMNRMKQSVGHVSTEFLRNATSGRSTYGYFARAVASTVSGNWVNE
FT                   MALSPSEALSSIIGAARTLVNRSGAVNLPLLLHPSLVRMTGLPREDHKKLRELLLGTTA
FT                   LDNGPQYSLGGYYTSVSSLITTTASDRHGYTPLPREATTAYLSCAADPLEVNVLTQAGV
FT                   SVVSAMEEASFRKSLPARYTGYETLRLGPKSLIRSIGTASVVDLISASPPRGVLERYPL
FT                   LTLAKRRLPEYLVRWAVSIAGGNPSAPDIGMEAWGEFKHGCMIATPMSYSDAATFGKRT
FT                   VSTVLTCPLDAHV"
XX
SQ   Sequence 5133 BP; 1058 A; 1547 C; 1372 G; 1155 T; 1 other;

AF337175  Length: 5133  December 9, 2003 08:57  Type: N  Check: 8773  ..

       1  gcagtgataa gacgccagtc gataccgaaa ggttcccgct tgcgtgcgtt
      51  ccctactact gggagtgcgg gattccgagt gtccttttat ctattactcg
     101  tgttgtgaga tatggcgaaa gccccctatc tcgctgtgtg ccccatggtc
     151  ccctggaccg cgcaaccgtg acctgaaaag actcttggta gcatcgggct
     201  ttgttatagt ggttgggcga gggttccgaa gacccctaaa ctacaacaat
     251  tgcacactta cacaacttct caactatggc caacgcctac gagaccaatt
     301  tccagactgc caatgctagc ccacttactg ggaccctagc tgacccggtc
     351  ggtggcacta tccaagccga ccactaccgc cgctatcgcg ccggtgtctt
     401  catgtccgtc ccggatatgg gccatgtgag caacgtggga cgcagcatct
     451  tctatgaagt tgggcgtcat cacggccgtg ctcgcgacct cctagccgcg
     501  cctcacgcgg aagccattcc tatcgactgc agtgtcgata tcaatgctgc
     551  tgaagcagca aattttgaag ggatggctcg ccgtttctcg aattttagcc
     601  ctcagtgggt taaaatggac ttggctggca tggtcgaacg ccttgctaag
     651  ggtgttactg ccgccggtgt tttcggtggt atcgacactg gcactctacg
     701  gggtggccag gcaatccggg ttaccgcact cggtaccctg gattcgcccc
     751  agacggcgtc tatcaacagt gtcttcatcc cccgcactgt tgacaccgtc
     801  ggcaacgacc acgtttttgc cgtccttgta tccgccgcaa acggggaagg
     851  ggctgctgtc actaccgacg tggtccggct ggatgccaac actaaccagc
     901  ctatgatccc agcagtggca ggcgcctcct ttgccactgc ttgtgttgaa
     951  gccctccgta tcctcggggc taacatggag gcatcaggcg caggcgatgt
    1001  cttcgcttac gctgtaactc gcggcgtcca cgccggtgtg tcagtggtcg
    1051  cccatactga cgaaggcggc tggttccgca atgtcttaag acatgaccgt
    1101  ttccgcgtcc cgtatggcgg cataaaccaa gggctgcgtc agtaccccgc
    1151  cctcccggcc ttggcatcga cttcaccttc gtcgatagca gcatgggcag
    1201  acgctatcgc cctgaagacc gccgctgctg tcgcccactg tgaccctctc
    1251  gttcctggtg aaggtggatg gtatccgtca gtcttcacgg ctggacaaaa
    1301  cggaacttct gctcccgggt ctagtgagag cgctgaagtc ggagaccagg
    1351  aagcccgttc gatcggtagg cagattgcct ctgatatcgg gcgtttcgcg
    1401  cctgcgtact gccgtgcgct gggtacactc ttcgggctgc acacatcaag
    1451  cggtgtcgca gaaagccacc tttcaacggt cgctatgcgt gctctgaccc
    1501  aggacgtgaa cacagaccgt catctgcgac acgaaaccgt cgccccctac
    1551  ttctggattg agcccacttc gctcatagct gtcaacgcgt ttggtacccc
    1601  tgccgaagca gaggggtacg gatcaaaagt cactccgggc gatacacgaa
    1651  gtgaaccatg cttcgaacgt ttcaggctgt tgcagaaagg ttctactgcc
    1701  aaccacatga cagtagcgtt caagatgcgt acggcccgga cttcggctct
    1751  ggtcagcgcg tacgctgcag cacctgctcc cctagcagac ctcaagctgt
    1801  accagttcga tgagtcttct gtwgtgttgc ccggcgacca gctacccact
    1851  cagggtgacg tagctcacaa acacgccgct gccgacccac tctcttcata
    1901  cctatggaag agaggccagt cgtgtttccc tgcgcccgcg gagttcatta
    1951  atacgaactc taattacggc gctaaagtta ggttagttac gtgggacgat
    2001  gatttcaacg cttccctgtc tgacctccct aacgatgagg agatggcgac
    2051  tggtgttgtc acgttccgcg tgacagtccc gaccggcctc gcgagtgctg
    2101  gtagcaacgc tgaaaaccgc gaggctaaac gtgcgcgtac gcgtggagct
    2151  atcgctctag cccaggcagt cttgcgtgcc agggccactg ggctggctgt
    2201  ttctccttca atggagatca gtgacgtgcc gcctacgttc gacacgcccc
    2251  ccctactccc ggctccaacg tatagcgaca cccagtctgc ttccggaccg
    2301  cgtgaccctg ggccggtgcc agtactcgct gttggtggtg gcctggacgt
    2351  cggtagagta gcgcgtggtg cgcctttacc ccctacagcg catcacatgc
    2401  cgcaacgcgc gcccaggatt gccggtgcgg tcgtaccacc cggtggacct
    2451  gtcgctggcc ctccagccgc taccggcggc cctgcagctc ccaacgtccc
    2501  cccgccccct cctgctggtc ccctcgattc tcaggaccct ctccctgccc
    2551  ctcccgccca cctgccagcc gaagctactg ctgctgaagc agtgcccgct
    2601  caatgattga gtcccccgtg tccgtacgag ctaatgaagc cggcatcgta
    2651  ggacaatacc tgaaagggct tctcaacatg gagtgggcgt ctggcgttat
    2701  ggtgttatct ttttcccagc agatctcgga ggtctacaaa ccaacattca
    2751  acggtttgag gccgacagac ttacaaagag cggctgctgc gtaccttgtt
    2801  cccgattttc ctgtgcaggt ccgcatcgag cgtggatctg tactctcttt
    2851  actatctcaa gtcatcgacc ccccggctag agtgaccgac cgctgttcgt
    2901  tccggtggtt gtgtgatcca aaggcgtcct atgctgcgtt cccaccaaag
    2951  caacatccgg gcgctatgaa taaagtgaac gtatacctca acgaggtggc
    3001  atcctctctc ctctccctgg atccagccgc ctactcttct gctagccaag
    3051  ccctctggcc acacaaaggg aagatagcca acgaccaagc aagtgccatt
    3101  attctatacg gctacggtct gcgtgcacag gccgtacctg acgccatgca
    3151  tgtggctgct acgctcgcga ccacccccga cctggcgaag gccctcacta
    3201  acttcctcaa agcaacaggc gccaacggtt cgcgtctggg tgctctcctg
    3251  tgcgagagca atgtccttct aggccgagcc gctgggcctg ctgacctctc
    3301  tgaggaggct cggtatcgta cgagtagcga tgtcgagagt cacctggcta
    3351  tctttagtga tgctgactta ggtgcagcta tcgacgccat cttggacgag
    3401  gagatcaaac gagttgaagg ctcacagcac attgagtttg actcatacca
    3451  agagcattgg aatgatcggt gggcttgggc agtcaacgga gcccattcag
    3501  gccacgtctc aaggttgtac ccccgtgtcc caaagccacc aggtatgctc
    3551  cgcgaacaca gacgcgcctg gctcgaaagt gtgactgaag atcctcgcac
    3601  cgactgggac ggcaagacat tcgtgtccgc atccccgaag ctggaagccg
    3651  ggaagactcg agcaatcttt gcttgtgata ccgtaaatta ccttgctttc
    3701  gagcacttgc tcgcaccggt agagaaacgt tggcggaatt ctaaagtgat
    3751  tctagatccc ggacgtggcg gtcatctcgg catgattttc cgcactacgg
    3801  ccgctcgcgc ccgtgccggt gtctccatga tgttggatta cgacgatttc
    3851  aattcgcacc attctacacg agcaatgcag atgctgttcc aacgtttagg
    3901  agaccgcgtt ggttacccag ctgacaaact ggctaaactt gtcgcttcat
    3951  tcgagaagat gtatatatac aatggaatgg agcaagttgg tcgtgtgaag
    4001  ggtacactga tgagtggcca tcgaggcacg actttcatca attccgtctt
    4051  gaacaaggcg tatctcctta tcgtattagg agaagatttg ttcgagcgca
    4101  gcgtggcctt gcacgtgggt gatgatgtat acttcggcgt acgtacgtac
    4151  gctgaagcgg gcgaggtcgt cacccggatt aagaactcgc ccttgcgtat
    4201  gaaccgaatg aagcaatcgg taggtcatgt atctactgag ttcttacgta
    4251  acgccacctc aggccggtct acctacggat atttcgctcg tgctgttgcc
    4301  agcaccgtat ccggaaactg ggtgaatgag atggctctca gtccaagcga
    4351  ggcgctcagc tctataatcg gggctgcgcg cacactcgtg aaccgatccg
    4401  gcgcagtaaa cttgccactg ctcctccacc caagtcttgt tcgcatgacg
    4451  ggtttaccaa gggaggacca caagaagctg cgcgaattgc tgttggggac
    4501  aacagctttg gataatggcc cccaatacag cctggggggc tactacacat
    4551  ccgtcagcag cctaatcact actaccgcta gtgaccgtca cggctacact
    4601  ccactccccc gtgaggcaac aacagcatat ttaagttgtg ccgcggaccc
    4651  gctcgaagtg aacgtgttga cccaagctgg tgtcagcgtt gtcagcgcaa
    4701  tggaagaggc gagtttcagg aagtcgcttc cagctcgcta tactggctac
    4751  gagacattac ggctaggccc taagtcattg atcaggtcta taggcacagc
    4801  atccgttgtt gacctcatct ccgcttcccc tccccgcgga gttctagaac
    4851  gctaccctct cctcaccctg gcaaaaagga gactcccaga gtacttagta
    4901  cgctgggcag tttctatcgc cggtggcaac ccttctgctc ccgatatcgg
    4951  catggaggcc tggggagagt ttaaacacgg ctgcatgatt gcgactccga
    5001  tgtcgtattc agatgcagcc acctttggca agcgaacagt ttcgactgta
    5051  ttaacttgcc cacttgacgc ccacgtgtaa gccaccccag cttacggtgt
    5101  caagaaattc gaggccccaa ggggccaaat tgc