Sequence of DPV Citrus tristeza virus

Citrus tristeza virus coat protein gene, complete cds.

ACC No: AF339088

Dated: 2001-03-29 | Length: 672 | CRC: 1869581619

                !!NA_SEQUENCE 1.0
ID   AF339088   standard; RNA; VRL; 672 BP.
XX
AC   AF339088;
XX
SV   AF339088.1
XX
DT   29-MAR-2001 (Rel. 67, Created)
DT   29-MAR-2001 (Rel. 67, Last updated, Version 1)
XX
DE   Citrus tristeza virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Choi S.H., Lee S.Y.;
RT   "Nucleotide sequence of coat protein gene of citrus tristeza virus isolated
RT   in Korea";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Choi S.H., Lee S.Y.;
RT   ;
RL   Submitted (22-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Graduate School of Biotechnology, Korea University, 1, 5-ka, Anam-dong,
RL   Sungbuk-ku, Seoul 136-701, Republic of Korea
XX
DR   SPTREMBL; Q991G6; Q991G6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="South Korea: Cheju Island"
FT                   /db_xref="taxon:12162"
FT                   /note="CTV"
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus unshiu"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q991G6"
FT                   /product="coat protein"
FT                   /protein_id="AAK26823.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPDLLDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   DTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 126 C; 167 G; 179 T; 0 other;

 AF339088  Length: 672  December 21, 2001 15:31  Type: N  Check: 84  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgac gttgttgccg ctgagtcttc tttcagttcc ataaacttac
     101  acatcgatcc aactttgata gcgatgaatg atgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctgac ttacttgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cggacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacaa
     401  acgcccttcg agtttggggt agaactaatg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga