Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate TAM11 coat protein gene, complete cds.

ACC No: AF342890

Dated: 2009-09-05 | Length: 672 | CRC: -1737796101

                ID   AF342890; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AF342890;
XX
DT   30-MAR-2001 (Rel. 67, Created)
DT   05-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate TAM11 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-672
RX   PUBMED; 19642988.
RA   Herrera-Isidron L., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Sequence diversity on four ORFs of citrus tristeza virus correlates with
RT   pathogenicity";
RL   Virol. J. 6:116-116(2009).
XX
RN   [2]
RA   Herrera-Isidron L., Villarreal-Garcia L.A., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular Analysis of Citrus tristeza virus from Mexico";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Herrera-Isidron L., Villarreal-Garcia L.A., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   ;
RL   Submitted (26-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Biotecnologia y Bioquimica, CINVESTAV Irapuato, km 9.6 lib.
RL   norte Carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="TAM11"
FT                   /mol_type="genomic RNA"
FT                   /country="Mexico:State of Tamaulipas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q990P2"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q990P2"
FT                   /protein_id="AAK27476.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVDVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 128 C; 166 G; 180 T; 0 other;

af342890 Length: 672  05-SEP-2009  Type: N  Check: 2486  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgac gttgttgccg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  atatcctaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gatgtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgt tagatgcagg
     501  gattccggcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga