Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate NL8 coat protein gene, complete cds.

ACC No: AF342891

Dated: 2009-09-05 | Length: 672 | CRC: -1828353054

                
ID   AF342891; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   AF342891;
XX
DT   30-MAR-2001 (Rel. 67, Created)
DT   05-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate NL8 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-672
RX   PUBMED; 19642988.
RA   Herrera-Isidron L., Ochoa-Sanchez J.C., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Sequence diversity on four ORFs of citrus tristeza virus correlates with
RT   pathogenicity";
RL   Virol. J. 6:116-116(2009).
XX
RN   [2]
RA   Herrera-Isidron L., Villarreal-Garcia L.A., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   "Molecular Analysis of Citrus tristeza virus from Mexico";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Herrera-Isidron L., Villarreal-Garcia L.A., Rivera-Bustamante R.,
RA   Martinez-Soriano J.P.;
RT   ;
RL   Submitted (26-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Departamento de Biotecnologia y Bioquimica, CINVESTAV Irapuato, km 9.6 lib.
RL   norte Carr. Irapuato-Leon, Irapuato, Guanajuato 36500, Mexico
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NL8"
FT                   /mol_type="genomic RNA"
FT                   /country="Mexico:State of Nuevo Leon"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q9IFW4"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q9IFW4"
FT                   /protein_id="AAK27477.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 122 C; 170 G; 181 T; 0 other;

af342891 Length: 672  05-SEP-2009  Type: N  Check: 2796  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgaa gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgatt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg acgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga