Sequence of DPV Beet black scorch virus

Beet black scorch virus, complete genome.

ACC No: AF452884

Dated: 2006-09-14 | Length: 3644 | CRC: 1965055530

                ID   AF452884; SV 3; linear; genomic RNA; STD; VRL; 3644 BP.
XX
AC   AF452884;
XX
DT   04-DEC-2002 (Rel. 74, Created)
DT   14-SEP-2006 (Rel. 89, Last updated, Version 6)
XX
DE   Beet black scorch virus, complete genome.
XX
KW   .
XX
OS   Beet black scorch virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3644
RX   DOI; 10.1007/s00705-002-0896-1.
RX   PUBMED; 12491108.
RA   Cao Y., Cai Z., Ding Q., Li D., Han C., Yu J., Liu Y.;
RT   "The complete nucleotide sequence of Beet black scorch virus (BBSV), a new
RT   member of the genus Necrovirus";
RL   Arch. Virol. 147(12):2431-2435(2002).
XX
RN   [2]
RP   1-3644
RX   PUBMED; 16963767.
RA   Yuan X., Cao Y., Xi D., Guo L., Han C., Li D., Zhai Y., Yu J.;
RT   "Analysis of the subgenomic RNAs and the small open reading frames of Beet
RT   black scorch virus";
RL   J. Gen. Virol. 87(PT 10):3077-3086(2006).
XX
RN   [3]
RP   1-3644
RA   Cao Y., Yu J., Cai Z.;
RT   ;
RL   Submitted (28-NOV-2001) to the EMBL/GenBank/DDBJ databases.
RL   State Key Laboratory for Agrobiotechnology, China Agricultural University,
RL   2 Yuanmingyuan West Road, Beijing, Beijing 100094, China
XX
RN   [4]
RC   Sequence update by submitter
RP   1-3644
RA   Cao Y., Yu J., Cai Z.;
RT   ;
RL   Submitted (30-DEC-2002) to the EMBL/GenBank/DDBJ databases.
RL   State Key Laboratory for Agrobiotechnology, China Agricultural University,
RL   2 Yuanmingyuan West Road, Beijing, Beijing 100094, China
XX
RN   [5]
RC   Sequence update by submitter
RP   1-3644
RA   Cao Y., Yu J., Cai Z.;
RT   ;
RL   Submitted (08-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   State Key Laboratory for Agrobiotechnology, China Agricultural University,
RL   2 Yuanmingyuan West Road, Beijing, Beijing 100094, China
XX
CC   On Jul 8, 2004 this sequence version replaced gi:27414406.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3644
FT                   /organism="Beet black scorch virus"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /db_xref="taxon:196375"
FT   CDS             36. .2210
FT                   /codon_start=1
FT                   /transl_except=(pos:645. .647,aa:OTHER)
FT                   /product="82K protein"
FT                   /note="RNA polymerase; ORF2; produced by translational
FT                   readthrough of ORF1"
FT                   /db_xref="GOA:Q8B5S0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5S0"
FT                   /protein_id="AAN76814.3"
FT                   /translation="MDSIPYVILRILDFIFHSIFFPSLLFIINHNTTILWACACAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFKDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCDEMEERRAVLGPSYGKXGGLLCTSGFTTPTWRGNP
FT                   EGLLVKRGPPLAKPRKLYRFSGFGTHIRYGVHDHSLGNVRRGLVERLFMVETKDGLAPT
FT                   PQPTPGVYAKLSRFHDLVSANLTSTTRLTYEQFLGFYSGRKLERYQQAVESLAIRPIGV
FT                   QDAWLSTFVKAEKLNISAKPDPAPRVIQPRSPRYNVEVGRFLRHAEEHLFDAINRVYGG
FT                   RTVFKGLNADQAGMEMQAMWQEFDNPVGIGMDASRFDQHVSKEALEFEHKIWLSMYRGA
FT                   DRKTLSKLLGMQIHNRGLARCPDGEIRYTVEGCRMSGDINTSSGNCYIMCASVHNYCSQ
FT                   LGVKRFRLANNGDDCMLVVEAKDEARVRQGLIEYYRELGFTMKVEPTVYELEHLEFCQT
FT                   RPVLVDGAYRMVRNLHQGMSKDLHSLHDLGSRKAAEAWVSAVGSGGRVMNDGVPVLKSF
FT                   FMQFPLSSGPKTKSDMSVALQEDWKYKFNRTGCFKNLAPTPQSRYSFWRAFGVLPDEQI
FT                   ALENGFSRLSFDKLDQDTQEEVSLLQFSGA"
FT   CDS             36. .647
FT                   /codon_start=1
FT                   /product="22K protein"
FT                   /note="RNA polymerase; ORF1"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5R9"
FT                   /protein_id="AAN76813.1"
FT                   /translation="MDSIPYVILRILDFIFHSIFFPSLLFIINHNTTILWACACAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFKDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCDEMEERRAVLGPSYGK"
FT   CDS             2107. .2244
FT                   /codon_start=1
FT                   /product="5K protein"
FT                   /note="ORF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5R8"
FT                   /protein_id="AAN76815.3"
FT                   /translation="MNRLPWRMGFLVSALISWTRTPRRRSASSSSLGHENLTTFHGTTA
FT                   "
FT   CDS             2228. .2419
FT                   /codon_start=1
FT                   /product="7K protein A"
FT                   /note="ORF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5R7"
FT                   /protein_id="AAN76816.2"
FT                   /translation="MEQQRSEQRRERRVRSRSEDRKSMSDVGQSAVNREADVKKDMGPS
FT                   VSMTVVGENVEFTQHFHF"
FT   CDS             2421. .2618
FT                   /codon_start=1
FT                   /product="7K protein B"
FT                   /note="ORF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5R6"
FT                   /protein_id="AAN76817.2"
FT                   /translation="MSIIYVVQEKPSGFLVWALVVAIVCIIGLLSYTPPERLNHSYHEN
FT                   NQKTQYITIGGASTSKVSTN"
FT   CDS             2647. .3345
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="virus shell; ORF6"
FT                   /db_xref="GOA:Q8B5R5"
FT                   /db_xref="HSSP:Q9IPS9"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8B5R5"
FT                   /protein_id="AAN76818.2"
FT                   /translation="MAPKRNKGGKKSRMSDETVRAPAAGGVIQRTPGIPPRIRSTTIGT
FT                   RVTNTELLAGVNVAAAGAFSVVGAGLFPSNLGWLNGIASNYSKFRWLAIKLIYIPIVPT
FT                   TTAGAMTMALSYDPADATPTSFQQVQQMYNSITAPVWAGFDGATVQLLGERPTTGAVCI
FT                   DVDVNRFGFTWYRYATLAAITALTANDRNLYIPSVCNVATSGGTAATNVGNLMIKYSIE
FT                   LIEPIPAAIN"
XX
SQ   Sequence 3644 BP; 895 A; 862 C; 946 G; 941 T; 0 other;

af452884 Length: 3644  14-SEP-2006  Type: N  Check: 3657  ..

       1  aagaaaccta accagtttct cgttgatcag cgatcatgga ttcaatcccg
      51  tatgtgatcc tgcgcatact cgattttatc ttccactcca tcttctttcc
     101  atctttactc tttatcatca accacaacac caccatcctg tgggcatgtg
     151  cctgtgccta tgggttctac cgtgcattcc gcctcatctt caagataaag
     201  gtggaagtac acccagccac ccgagccgtc ttcaaggata tggtcactcg
     251  cttccagcgg gagagtatgt tctcacctga cgacgaagtg ccggagggca
     301  tccctatcca cgaggatgtt gaccttgtta gcgaccccac acacaaagat
     351  attaagcggg tccgtgctag caggcgagtc tcttatgccg tgagggttgc
     401  ccatgtagcc aagtctaagg tgggattgct cgccaatacc aaggcgaatg
     451  agctggtgta ctcccgtctt tgccgagacg agatggttac ccacggtgtg
     501  cgcccatcgc acattgcaca cgcagtgccg cttgctgtcg cggcctgctt
     551  cataccgttg gacagtgatt tccttgcagc ttctattaga aactgcgatg
     601  agatggagga gcggagggcc gtactagggc cctcatatgg aaaataggga
     651  ggcctactct gcaccagcgg gtttaccacg cctacttggc gtggtaatcc
     701  agagggtttg ctggtgaaga gaggaccacc tctggctaaa cctaggaaac
     751  tgtaccgttt ttctgggttt gggactcata tacggtacgg agtgcacgat
     801  cactcattgg gcaatgttcg gaggggactt gttgagcggc tattcatggt
     851  tgaaaccaag gatggcttag ctccaacacc acagcccacc cctggcgtgt
     901  acgccaagtt atcccggttt catgaccttg ttagtgccaa cctaacctcg
     951  accaccagat taacatacga gcaattcctc ggattttatt ctggtcgcaa
    1001  attagagagg taccaacagg ccgtggagtc gttagcaatc cgcccaatag
    1051  gggtacagga tgcttggctt agcacgtttg ttaaggctga aaaattaaac
    1101  atctcagcca aacccgaccc ggcacctagg gttattcagc ctaggtcgcc
    1151  gaggtacaat gtggaagttg gacggttcct cagacacgct gaggaacatc
    1201  tgttcgacgc catcaaccgt gtgtatggtg ggcgaacggt attcaagggg
    1251  ttgaatgccg atcaggctgg catggagatg caagctatgt ggcaagaatt
    1301  cgacaatcct gtgggtattg gtatggatgc ctctcgtttc gaccaacacg
    1351  tctctaagga ggcgttggag tttgaacaca aaatctggct atccatgtac
    1401  cgtggggctg acaggaaaac attgtcgaag ctgttgggga tgcaaatcca
    1451  caaccgcggt cttgccagat gccctgatgg agaaatcagg tacacggttg
    1501  aggggtgtcg tatgtctggg gacatcaaca catcttctgg aaactgctat
    1551  atcatgtgtg cttcggtgca caattattgc agccagttgg gtgtcaagag
    1601  attcaggctt gccaacaatg gtgatgattg catgcttgtc gtcgaagcca
    1651  aggatgaagc acgtgtcagg cagggactca tcgagtatta tagggaattg
    1701  ggtttcacca tgaaagtgga acctacagtc tatgaactcg agcacttgga
    1751  gttttgccag acacgtccag tccttgtcga tggggcatat cgaatggtgc
    1801  gcaatcttca ccagggcatg tctaaggatc ttcactcctt gcacgatctt
    1851  ggtagtagga aagctgctga agcttgggtt tcagcggttg gtagtggagg
    1901  ccgcgtgatg aatgatggag taccagtgct caaatcattc ttcatgcagt
    1951  ttcccctatc ttctggacct aaaaccaagt ctgacatgag tgtagcgttg
    2001  caggaagatt ggaaatacaa attcaatcgg actgggtgtt tcaagaactt
    2051  ggcacccact ccacaatccc gctactcatt ttggcgtgcg tttggagtgc
    2101  taccagatga acagattgcc ctggagaatg ggttttctcg tctcagcttt
    2151  gataagctgg accaggacac ccaggaggag gtcagcctcc tccagttctc
    2201  tggggcatga aaacctaacc acttttcatg gaacaacagc gtagtgaaca
    2251  acgtcgtgag cgtagagtga gaagtagatc ggaggacagg aagtctatgt
    2301  ctgatgtagg gcaatctgct gtcaataggg aagcagatgt caagaaagat
    2351  atgggtccat cggtttctat gacggtggtg ggggagaacg tagagtttac
    2401  acaacatttc cacttctgaa atgagcatca tttatgtcgt acaggagaag
    2451  ccctctgggt ttctcgtgtg ggcattggtt gttgcaattg tgtgcattat
    2501  tggactctta tcgtacactc cacctgaaag acttaaccac tcttatcacg
    2551  aaaacaatca gaagacgcaa tacataacta ttggaggagc atccactagt
    2601  aaagtttcca cgaactgaat tttctgcttt ctagtatagt caataaatgg
    2651  cacctaagcg caataaagga ggcaagaagt cccgcatgtc cgatgagaca
    2701  gtgcgggctc ctgctgcagg gggcgttata caacgcacac ctggcattcc
    2751  tccccgcatt aggtccacca ctattggtac gcgtgtcacc aacactgagc
    2801  tgctcgctgg agtgaatgtc gctgcggcgg gagctttctc agttgttggc
    2851  gctggtcttt tccccagcaa ccttggttgg ctcaatggga ttgcttccaa
    2901  ttatagcaaa tttagatggc ttgctatcaa gctcatctac attcccattg
    2951  ttcctaccac gaccgctggg gcaatgacca tggctttatc gtatgatcct
    3001  gctgatgcta cgccaactag tttccaacaa gtgcaacaga tgtataacag
    3051  catcacagca cctgtctggg ctggatttga tggagctact gttcagctgc
    3101  taggggagag accaacaact ggggctgtgt gcattgatgt ggatgtaaat
    3151  cggtttggat ttacatggta cagatatgct acgcttgctg ccattaccgc
    3201  actcactgca aatgatagga atctttatat tcctagtgtt tgcaatgtgg
    3251  ctacgtctgg tggtactgca gccaccaatg ttggcaatct gatgataaag
    3301  tacagcattg agctcattga gccaatacct gctgccatta attagatccc
    3351  acatcctggt gtggttaatc cagtgaaaaa tattaggaaa tccttgggat
    3401  tcacacccca gggaggattg cttgcatagt gcaggtatgt tgagttacac
    3451  tatgaggtat tggtgctgaa tcctggtaaa caggcttgac aggtttgggt
    3501  ggttccagac cgatgtatta cccaagatac tcatggtact ctactagaaa
    3551  acactatgcg tgcgcacacg gctggctatg tcctatcata gctgggggcc
    3601  ccggagtgcg aaaccctctt atatacctgg tcttccaggt gccc