Sequence of DPV Citrus tristeza virus

Citrus tristeza virus coat protein gene, complete cds.

ACC No: AF501870

Dated: 2003-04-03 | Length: 672 | CRC: 1183515589

                !!NA_SEQUENCE 1.0
ID   AF501870   standard; RNA; VRL; 672 BP.
XX
AC   AF501870;
XX
SV   AF501870.1
XX
DT   06-MAY-2002 (Rel. 71, Created)
DT   03-APR-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Citrus tristeza virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   MEDLINE; 22548851.
RX   PUBMED; 12664295.
RA   Roy A., Ramachandran P., Brlansky R.H.;
RT   "Grouping and comparison of Indian citrus tristeza virus isolates based on
RT   coat protein gene sequences and restriction analysis patterns";
RL   Arch. Virol. 148(4):707-722(2003).
XX
RN   [2]
RP   1-672
RA   Roy A., Ramachandran P., Brlansky R.H.;
RT   ;
RL   Submitted (12-APR-2002) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Florida, 700, Experiment Station Road, CREC,
RL   Lake Alfred, FL 33850, USA
XX
DR   SPTREMBL; Q8JYU8; Q8JYU8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /country="India:Nagpur"
FT                   /db_xref="taxon:12162"
FT                   /organism="Citrus tristeza virus"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q8JYU8"
FT                   /product="coat protein"
FT                   /protein_id="AAM22219.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLALKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRXADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 189 A; 122 C; 178 G; 182 T; 1 other;

 AF501870  Length: 672  April 15, 2003 08:31  Type: N  Check: 4732  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gctgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttgctc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gangggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga