Sequence of DPV Coniothyrium minitans RNA virus

Coniothyrium minitans mycovirus putative coat protein and putative RNA-dependent RNA polymerase genes, complete cds.

ACC No: AF527633

Dated: 2003-05-06 | Length: 4975 | CRC: -1228589072

                !!NA_SEQUENCE 1.0
ID   AF527633   standard; RNA; VRL; 4975 BP.
XX
AC   AF527633;
XX
SV   AF527633.1
XX
DT   02-JAN-2003 (Rel. 74, Created)
DT   06-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Coniothyrium minitans mycovirus putative coat protein and putative
DE   RNA-dependent RNA polymerase genes, complete cds.
XX
KW   .
XX
OS   Coniothyrium minitans mycovirus
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RP   1-4975
RX   MEDLINE; 22614052.
RX   PUBMED; 12727341.
RA   Cheng J., Jiang D., Fu Y., Li G., Peng Y., Ghabrial S.A.;
RT   "Molecular characterization of a dsRNA totivirus infecting the sclerotial
RT   parasite Coniothyrium minitans";
RL   Virus Res. 93(1):41-50(2003).
XX
RN   [2]
RP   1-4975
RA   Cheng J., Jiang D., Fu Y., Li G., Peng Y.;
RT   ;
RL   Submitted (06-JUL-2002) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, Shizishan
RL   No.1, Wuhan, Hubei 430070, P R China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4975
FT                   /db_xref="taxon:210827"
FT                   /mol_type="genomic RNA"
FT                   /organism="Coniothyrium minitans mycovirus"
FT   CDS             62. .2389
FT                   /codon_start=1
FT                   /note="CMMV-CP"
FT                   /product="putative coat protein"
FT                   /protein_id="AAO14998.1"
FT                   /translation="MASSTRFLASAASPLTGTVAGISAGTIGQDNQYRRYRAGLTIGVH
FT                   EHGSYTQARRSIFYEVGRRYGRLTDALGPHGAEAVPIDASVRINAAEAANFEGFARKFS
FT                   NFSPQWLTMDLCGIAERLAKGVAAQSVYGGVNIVNLRGHLPVRVVALGTLDSPQTASNN
FT                   SVFIPRTVDTVGNDHVFAVLAAAANGEGAAVSTDVLRLDANTNEPVIPAVSGPSLASAC
FT                   IEALRIVGANMEASGAGDLFAYAVTRGIHAVVSVVAHTDEGGYMRALLRHGRFRVPYGG
FT                   INQALRDYPALPAAGALATHVISSWVDAIALKTAAVVAHSDPCVIASGGLYPTVFTSSQ
FT                   GDITPPGTDEGDSPTDADARAIGRQIAGDLGRFAPTFMAGLLRIFGLQTSSQVAEAHFC
FT                   TVGGMYLSENVDRHLRHKTVAPYFWVEPTSLIEVGFLGSTAETAGFGSLVTPGDQAMIP
FT                   TFERVREMDRGRNANFSTIAFKMRTARTSGLVCAHAAAPTPLAGLKLYQFDQDSLILAG
FT                   DQGPTNGDVPTKHVAADPLSSYLWVRGQSAIPAPAEMINTQASYAAKYKNITWDDDFEG
FT                   TVSDLPKAWELEHDTMWRVTVPTAFSVTGPSNYLDREARRARSRAAISLAQAALRARAY
FT                   GEANSPVIDVSNVPPTWDDERAPVVVFSDEIHTSDPGTAQGRGIGNPPDVTAPVTGAPL
FT                   VPIPHHQPLRGPPFPRGAGVMGGGVAPPPPAGPGGPPAGPGPNPPPPPPPGGDGGDDAA
FT                   AAAAVAGGDVHGAAGALPAPQV"
FT   CDS             2386. .4875
FT                   /codon_start=1
FT                   /note="CMMV-RdRp"
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /protein_id="AAO14999.1"
FT                   /translation="MIGARVDERALAAGALGQYLKKLTRSQDVSRFATLSFPDQISYVF
FT                   KPSWDSFRPTPLHRAALSFLCGEVPVQVALPYASLWRMVDYTCPVPDIVLDIKYKTRWI
FT                   RDAGITVKRFPLKKNPAASNKVNLYLHEVGRDLSSHAPTQLNVGLQYLDWVRRQRVVYN
FT                   DQATAFLLYEYCLACYDSRGWRHAAASLFDSDYAKGFSVFGKAVGINGSQVGAMMVETN
FT                   VLLGRDVAPIDLVEEARKRTSMREVRAMTTAYSDDTIRRAVRTVLLRELKRSGDSYILE
FT                   FPTLEDHWATRWQWAVNGAHSGLIYKTNPSYRPHMPGFDRLHRRAWLETISEDPRPAWD
FT                   GRTYVSASPKLEHGKTRAIFAWDTINSLAMEHLMSTVEANWRGERVILNPGKGGHLGMA
FT                   QRVQAARNRSGVSLMLDYDDFNSHHTTRTMQIVVEETCRLTGYPPDLAEKLVSSMEKHY
FT                   ICVGGAYIGRSKGTLMSGHRLTTYINSVCNEAYLRIELGDDFLDKNVSLHVGDDVYLGV
FT                   RSYQEAGYVLRMIRGSKLRMNPAKQSVGHVTTEFLRVASESRYSYGYLARAVASITSGS
FT                   WVNELALAPLEALTNIVASARSLANRSGIADVALLLVSSTRRMAPLDSRDDTLLRELLT
FT                   GKVALQNGPNYQSSGYYRHVAVTPKMVRRDDFGYGVLPLEATHTYLSSAATVLEIETLT
FT                   KAGISVEEDMARASYKKSAPRDFFSAECLVTGPVLQRPCVGVEWAEMVLRRPRVTGILS
FT                   RYPLLLLARYRLPERVVREALAAAGGDYNTPYLDYDAWGEYAHGCVIDTVMSYTDASAL
FT                   GAKTAAGVLTSTTRMYV"
XX
SQ   Sequence 4975 BP; 1008 A; 1527 C; 1416 G; 1024 T; 0 other;

  AF527633  Length: 4975  May 13, 2003 09:00  Type: N  Check: 6246  ..

       1  agggttccgt tgatccacct gctcaacgtc gatttcacga aagcctaacc
      51  atctgttgcc aatggcatca agcacgcgtt tcctcgcgtc ggccgccagt
     101  ccgttaactg gtacagtcgc gggtatctcg gcgggtacca tcggccaaga
     151  caatcaatac cgccgataca gagccggcct tactatcggg gtccacgaac
     201  acggttcgta tacccaggct cgccggtcca tcttctacga agtgggccgc
     251  cgatacgggc gtcttacaga cgccctaggg ccacacggtg ccgaggcagt
     301  gcccattgat gcgagtgttc gcatcaacgc tgctgaggcc gctaatttcg
     351  agggctttgc ccggaagttt agcaatttca gcccccagtg gctgacaatg
     401  gacctctgcg gtatcgcgga gcgtctggca aaaggtgttg ccgcccagtc
     451  cgtgtacggc ggggtcaaca tcgttaattt gcgtggacac ttgcctgtcc
     501  gtgtcgtggc gctcgggact ctcgactccc ctcaaacggc gtcaaacaac
     551  tcggtcttca taccgagaac ggtcgacacg gtcggtaatg accatgtttt
     601  tgctgtcctc gcggccgcag ccaacggcga aggagcagct gtgagtacag
     651  atgtactcag gctcgatgcg aacaccaacg agccggttat tccagctgtc
     701  tccggtccct cgctggcctc ggcctgcata gaggccctcc gtatagtcgg
     751  ggccaatatg gaggcgtccg gggccgggga tttgttcgcg tatgctgtca
     801  cgagaggcat acacgccgtc gtttcggtcg tcgcccacac cgatgagggg
     851  gggtacatgc gtgccctcct ccgtcacggg cgtttcagag tgccgtacgg
     901  cggcatcaat caagctctgc gtgactaccc cgcgctgccc gccgctggcg
     951  cactcgccac ccacgtcata tcgtcttggg tggatgcaat tgcgctgaag
    1001  acggcagcgg tcgttgccca cagcgaccct tgtgtcatcg cgtctggtgg
    1051  cctttacccg actgttttca ctagcagtca gggcgacatc accccgcccg
    1101  gaactgacga gggtgattcg cccactgatg ctgacgcccg tgctattgga
    1151  cgtcagattg caggggacct gggccggttc gccccgacct ttatggcggg
    1201  cctgctcagg atcttcggac tccagacgtc aagtcaggtg gccgaagctc
    1251  acttctgcac cgtggggggg atgtatctgt ccgagaacgt cgacaggcac
    1301  ctccgccaca agacggtggc tccgtacttc tgggtggagc cgacctcgtt
    1351  gatagaggtc ggtttcctcg gttcgaccgc ggagaccgcc ggttttgggt
    1401  ctcttgtaac ccctggagac caggctatga ttcccacctt cgaaagggtg
    1451  cgtgagatgg atcgcgggcg caatgcgaac ttctccacga tagccttcaa
    1501  gatgaggacc gctcgtacta gcggcctcgt ctgcgcccat gccgcggccc
    1551  ccacccctct ggcaggttta aaactgtacc aatttgatca ggacagtttg
    1601  atcctcgctg gtgaccaggg gcccacgaat ggcgatgtgc cgacgaagca
    1651  tgtcgccgcc gaccccctgt cctcgtacct ttgggtacgg gggcaaagcg
    1701  ccatcccggc ccctgccgag atgatcaaca cccaggcttc ttatgccgca
    1751  aagtataaga acataacctg ggatgacgat ttcgagggta cggtgtcgga
    1801  tctgcccaag gcctgggaac tcgaacacga cacaatgtgg cgtgtgactg
    1851  tcccaaccgc cttctcggtg accggcccgt ccaattacct ggatcgggag
    1901  gctcgtcgcg cacgttcccg tgccgcgatc tctttggcac aggccgcact
    1951  gcgcgcccgt gcatacggcg aggccaactc gcctgtcatt gacgtgtcca
    2001  acgtcccccc aacttgggac gatgagcggg ccccggtggt tgtattctct
    2051  gatgagatac acaccagcga ccccggcaca gcacagggca ggggcattgg
    2101  caacccgccg gacgtgaccg ctccggtcac tggcgcccct ttggtgccaa
    2151  tacctcatca ccaacccctc cgcggacccc ccttcccgcg cggcgctggt
    2201  gtaatgggag gcggcgtggc cccccctccc ccagccggtc ccggtggacc
    2251  gcccgctgga cctgggccaa acccaccccc gcccccaccc ccaggcggtg
    2301  atggtggtga cgacgcggcg gctgcagctg ccgtggcagg tggtgacgtt
    2351  cacggtgccg ccggagcctt accggctcca caagtatgat cggcgcccga
    2401  gtggacgaga gagccttggc agctggcgct ctcggccaat acctgaagaa
    2451  gctgacccgc agtcaggatg tgagcaggtt cgcaaccctc tccttccctg
    2501  accaaatttc ttatgttttc aaaccgtcct gggactcttt tcgtcccacg
    2551  ccactacatc gggccgcctt gtcattttta tgtggtgagg tccccgtgca
    2601  ggtggcgcta ccctacgcct ctctttggag aatggttgat tacacctgcc
    2651  cagtaccaga cattgtactg gatataaaat ataaaacaag atggattcgt
    2701  gacgccggta taacggtgaa aagattccct cttaagaaga acccggccgc
    2751  atcgaacaag gtcaacctgt acctacatga agttggtcgt gacttgtcat
    2801  cacatgcacc tactcagctc aatgtcggac tacagtacct cgattgggta
    2851  cgccgacaac gcgtggtgta caatgaccag gccaccgctt tccttctgta
    2901  cgaatactgt ctggcatgtt acgactctcg cggctggcgg cacgcagcgg
    2951  cctcgctctt cgacagtgac tatgccaaag ggttttctgt ctttggtaag
    3001  gccgttggca tcaacggttc gcaagtcggt gcgatgatgg tggagaccaa
    3051  tgttctcttg ggacgggacg tggccccaat agacttggtt gaggaagcca
    3101  ggaaaaggac ttcaatgcgt gaggtgagag ccatgacaac cgcttactcg
    3151  gacgacacga tccgccgggc ggttagaacg gtgctccttc gtgagcttaa
    3201  gcgctcaggt gactcgtata tacttgagtt ccccacgctt gaagatcact
    3251  gggcaacgcg gtggcagtgg gcggtgaacg gtgcacactc gggtttgatt
    3301  tataaaacca acccgagtta ccgcccccac atgccaggct tcgaccgcct
    3351  acaccgccgc gcctggttgg agacaattag cgaggacccg cgccctgcct
    3401  gggacgggag gacttacgta agtgcctcac ccaagcttga acacggcaag
    3451  actcgcgcca tcttcgcttg ggacaccatc aattccctcg caatggagca
    3501  cttgatgagt acagtcgagg cgaactggcg tggtgaacgg gtaatcttga
    3551  accccgggaa aggtggccac cttgggatgg cccagcgggt ccaggctgca
    3601  cgcaatagga gtggagtgtc gctaatgttg gattacgacg actttaactc
    3651  gcaccacacg acaaggacga tgcagattgt agtggaggag acatgccgac
    3701  tcacggggta ccccccagac ctcgctgaaa agttagtctc ttcgatggaa
    3751  aaacactaca tctgtgtcgg cggtgcatac attgggcgtt cgaaaggaac
    3801  cctcatgtcc gggcaccgat tgacaacgta catcaattcg gtttgcaacg
    3851  aagcttacct cagaatcgaa ttgggtgacg atttccttga caagaatgtc
    3901  tccctacacg tcggcgatga cgtgtacctg ggagtacgct cctaccaaga
    3951  ggcgggatac gtactgcgga tgatccgggg ttccaagtta cgaatgaacc
    4001  cggcaaagca gtccgtgggc cacgtaacaa ctgaattctt gcgagtcgcc
    4051  tcagagagta ggtactctta cggctacctg gctcgcgcag ttgcgtcaat
    4101  aacaagcgga agttgggtca atgagctcgc cctcgccccc ctcgaggcgc
    4151  tcaccaacat cgtcgccagc gctcgttcgc tggcgaaccg aagcgggata
    4201  gctgacgtgg ctctcctcct ggtgtcaagt acacgccgta tggccccact
    4251  tgatagccgg gacgacacgt tactccgcga acttttaact ggtaaagtgg
    4301  ctttgcaaaa cgggcccaac taccagagtt caggctacta tcgccacgtc
    4351  gctgtgaccc ccaaaatggt ccgtcgcgac gacttcggct acggtgtgtt
    4401  gcctctcgag gcgacacaca cctacctcag ctccgccgcc acggtgctcg
    4451  agatcgagac cctcactaag gctggcatct cagtagagga agatatggca
    4501  cgtgcgagct acaaaaaatc agctcctcgt gacttcttct cagcagaatg
    4551  cctggtcacc ggtcccgtcc tccagcgccc gtgtgtaggc gttgagtggg
    4601  cagagatggt cctgcgacgc ccccgcgtca cgggcatcct gtccagatac
    4651  cccctcctcc tacttgcccg ctaccggctc cctgagcgcg tagtacgcga
    4701  agccctcgcc gcggcgggag gagactacaa caccccgtac ctcgactacg
    4751  acgcatgggg tgagtatgca cacggctgtg tcatcgacac ggtcatgtca
    4801  tacaccgacg catccgcgtt aggcgccaaa acagcagctg gcgtcctgac
    4851  atctactacg cggatgtacg tttagataca ttgttgttgc tgtcaacaag
    4901  actctcggtc ggggagtcaa caatagaaca gtgcccccac cggggggaaa
    4951  tgacccccgg gatcctgcat aattc