Sequence of DPV Moroccan pepper virus

Moroccan pepper virus coat protein mRNA, complete cds.

ACC No: AF540886

Dated: 2005-04-15 | Length: 1176 | CRC: -192362872

                !!NA_SEQUENCE 1.0
ID   AF540886   standard; mRNA; VRL; 1176 BP.
XX
AC   AF540886;
XX
SV   AF540886.1
XX
DT   29-SEP-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Moroccan pepper virus coat protein mRNA, complete cds.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1176
RA   Russo M.;
RT   "Molecular characterization of a tombusvirus isolated from diseased pear
RT   trees in Apulia (Southern Italy)";
RL   Unpublished.
XX
RN   [2]
RP   1-1176
RA   Russo M.;
RT   ;
RL   Submitted (23-AUG-2002) to the EMBL/GenBank/DDBJ databases.
RL   Istituto di Virologia Vegetale Sez. Bari, Consiglio Nazionale delle
RL   Ricerche, Via Amendola 165/A, Bari 70126, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1176
FT                   /db_xref="taxon:208086"
FT                   /mol_type="mRNA"
FT                   /organism="Moroccan pepper virus"
FT   CDS             1. .1176
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8BC71"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q8BC71"
FT                   /note="capsid protein"
FT                   /product="coat protein"
FT                   /protein_id="AAN28378.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKAQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYAFNNV
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGPTTGPSYLTVSSTTTVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
XX
SQ   Sequence 1176 BP; 296 A; 272 C; 292 G; 316 T; 0 other;

 AF540886  Length: 1176  April 19, 2005 08:50  Type: N  Check: 3391  ..

       1  atggcaatgg tagtaagaaa caacaacaca gcattagtac cgtatagtgg
      51  aggcaaacgt ggcctccaga aagcatttgg atttggagct acaatcgtcg
     101  ggcaaaagat ttatgataat cgtggtaaga ttgtagggtt catggtagaa
     151  caaggaaaga aaggtctaag taagatggct aatgctctcg gttatggcaa
     201  tggtcagaaa gctcagaatc tggttggtgg gatgggtggg gccattatgg
     251  ctcctgttgc ggtctcaagg cagctccgtg gaagtaaacc ccggtttact
     301  ggacgcacag ctggttccgt taccgtcacc caccgtgagt atgtacgaca
     351  ggtaaacaac acgtctgcct tcacagtcaa tgggggtatt gtcgggaatt
     401  tgtatcaact gaaccctttg aacggtactc tgttcacttg gttgccctcc
     451  atagcatcca attttgatca atacgcgttc aataacgtca cgttgcacta
     501  tgtccccctc tgtagtacca ctgaggtagg tcgtgttgga ttatatcatg
     551  acaaagactc acaggatcct gagcctactg ataggcagga gttggcgaac
     601  tttagtaccc ttaaagagac acccccctgg ggtgaagtaa tgttgcgaat
     651  acccactgat aggatcaaga ggtactgcga tgacagtaac gcagtcgatc
     701  ataagctaat tgatttgggt caagtaggca ttgctacata tgggggtgct
     751  ggcgctaacg ccgtgggtga tgtgtttata tcgtatagca ttactttatt
     801  ctcacctcag cccactagct cattgcttag cacaagacaa cagagccttc
     851  tcggtgccac tggtcccacg accggcccga gttacttgac ggtgtccagc
     901  acgacgaccg ttctcacctt gacgtttaga gctactggca cctttatggt
     951  ctccggtcac ttccgtgata ctggggcagc cgtattaggt ctcgctggta
    1001  atatcaatgt aaattcactg acagtcttgg atacggttgg tttagccacc
    1051  tcgttttcca ttaattgttc agtgtctgct ttaccgtcta ccattacctt
    1101  tacctccaca gcaataacat cttccacggt acactgtgta cgggccgtaa
    1151  gggccaatga tgccacattg ttgtaa