Sequence of DPV Pelargonium flower break virus

Pelargonium flower break carmovirus (isolate PV 0202) coat protein gene

ACC No: AJ003153

Dated: 1998-03-03 | Length: 1500 | CRC: -1469143503

                !!NA_SEQUENCE 1.0
ID   PFBVCP     standard; RNA; VRL; 1500 BP.
XX
AC   AJ003153;
XX
SV   AJ003153.1
XX
DT   03-MAR-1998 (Rel. 54, Created)
DT   03-MAR-1998 (Rel. 54, Last updated, Version 1)
XX
DE   Pelargonium flower break carmovirus (isolate PV 0202) coat protein gene
XX
KW   coat protein.
XX
OS   Pelargonium flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1500
RA   Berthome R.;
RT   ;
RL   Submitted (26-NOV-1997) to the EMBL/GenBank/DDBJ databases.
RL   Berthome R., Biologie cellulaire, Institut National de la Recherche
RL   Agronomique, Route de Saint Cyr, 78026 Versailles cedex, FRANCE.
XX
RN   [2]
RA   Berthome R., Kusiak C., Renou J.P., Albouy J., Freire M.A., Dinant S.;
RT   "Sequence of the coat protein gene of pelargonium flower break carmovirus
RT   and its relationship with other small icosahedral viruses";
RL   Unpublished.
XX
DR   SPTREMBL; O56987; O56987.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1500
FT                   /db_xref="taxon:35291"
FT                   /sequenced_mol="cDNA to genomic RNA"
FT                   /virion
FT                   /organism="Pelargonium flower break virus"
FT                   /lab_host="Chenopodium quinoa, Nicotiana clevelandii"
FT                   /isolate="0202"
FT                   /map="3' region of the genomic RNA"
FT   5'UTR           1. .83
FT   prim_transcript 160. .1264
FT   CDS             227. .1264
FT                   /db_xref="SPTREMBL:O56987"
FT                   /evidence=EXPERIMENTAL
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAA05911.1"
FT                   /translation="MDAYKNDPIVRQAVAKGVAWAVKLNTRGWSSLTTQQKKVARSALS
FT                   VIQPPAVVVPRRTRVRNPVPAGLKSGNGKAGKSSTLTRSEFICNVSSTTGVTPTFQSWI
FT                   INPREVKSFPQSSVCSVGYNKYRITDFRIRFSTSCSDTMNGKVAIGFTPDSSDPVPVDK
FT                   SQLYGMQVYADTPAKESVTLKTAADNTIRFLRDSSSDDAKLVDYGRVVLATYGFDSTAP
FT                   SVIGELFFEYTVVYLDPTYVVALTQYGTLTTSSGPPYATLTTTATSTSIELNTHGKWLV
FT                   VWISADEVINSPVISGSGASGSVTVVSDAQTTVVAVVTANLPGAIISNTSTAAPSSLEW
FT                   YVSRL"
FT   3'UTR           1265. .1500
XX
SQ   Sequence 1500 BP; 375 A; 377 C; 392 G; 356 T; 0 other;

AJ003153  Length: 1500  December 21, 2001 15:34  Type: N  Check: 1547  ..

       1  atggtggtaa tgggggttct tgggttgttg tggctgagac cgtttcggtc
      51  aatatacact tcaactttta gtatgccccc tctgataaac ctccaacaca
     101  tactgaatct taccttgtta tccttgattc taagttcttt catcttggca
     151  gagagagtaa cgcacaatca gtactcaaac gacaacagca aagcgcaata
     201  tatacggatc tcaactgggc aatagtatgg acgcctacaa gaatgaccca
     251  atagttaggc aggcagtggc aaagggagta gcttgggcgg ttaagctgaa
     301  cactagaggg tggtcttcat tgaccaccca acagaagaaa gttgcgcgct
     351  cagctctgtc tgtgatacaa cccccagcgg tggttgtacc tcgcagaacc
     401  agagtacgaa acccagtacc cgcgggcctg aaatcaggga atggcaaggc
     451  agggaagagc tcaactctaa cccgatcgga gtttatctgc aacgtatcga
     501  gcacaaccgg ggtgaccccg actttccaat catggatcat aaatcctagg
     551  gaggtcaaaa gtttcccaca atcttccgtc tgctcggttg gctacaacaa
     601  gtacaggatc acggacttca ggattaggtt ttccacctcc tgttccgaca
     651  ctatgaatgg gaaggtggcc atcggcttca ctcctgattc tagcgatccg
     701  gttcctgttg ataagtcaca gctgtacggg atgcaggtgt atgccgacac
     751  cccagcaaag gagtcggtca ccttgaagac ggctgcagat aacacgatta
     801  ggttcctgcg ggattcatcc agcgatgatg ccaagctggt ggattatggc
     851  cgcgtagttt tagccacata cggtttcgat agcacagctc cgtcagtgat
     901  aggagagctg ttctttgagt acaccgtagt ttatctcgac cctacctatg
     951  tcgtggcttt aacacaatat ggcacgttga ccacctcatc tggcccccca
    1001  tatgctacct tgaccaccac tgccacttca acatccatag aattaaacac
    1051  ccatggaaag tggctagtgg tttggatctc ggcagacgag gtgatcaact
    1101  ctccggttat atccgggtcc ggggcaagcg gatccgtaac tgtcgtcagc
    1151  gacgcacaga ctactgttgt tgcagtggtc actgcaaact tgccaggtgc
    1201  catcatttcc aacacttcaa ccgctgcccc ttcgtcactg gagtggtacg
    1251  tatctaggct atgagagagc agtcacccta ccttctgcca gaggttcccg
    1301  gaggagtagt gatcctttgg gggtgattca tagcttggaa aggtcggaga
    1351  gttgggggga ggccaactgg gggaggtgct aggagcacca gaggcagtag
    1401  agcaaaaatc cgggtttcat cgcctggtgc gggcgctcaa tgctgctaac
    1451  aagttcctga aggaagaaag gttttggtcg atggagacct taacccgccc