Sequence of DPV Ophiostoma mitovirus 6

Ophiostoma novo-ulmi mitovirus 6-Ld mRNA for putative RNA-dependent RNA polymerase

ACC No: AJ132756

Dated: 2003-01-08 | Length: 2343 | CRC: 2403890

                !!NA_SEQUENCE 1.0
ID   ONO132756  standard; RNA; VRL; 2343 BP.
XX
AC   AJ132756;
XX
SV   AJ132756.1
XX
DT   10-MAY-1999 (Rel. 59, Created)
DT   08-JAN-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Ophiostoma novo-ulmi mitovirus 6-Ld mRNA for putative RNA-dependent RNA
DE   polymerase
XX
KW   pol6 gene; RNA-dependent RNA polymerase.
XX
OS   Ophiostoma novo-ulmi mitovirus 6-Ld
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus.
XX
RN   [1]
RP   1-2343
RA   Buck K.W.;
RT   ;
RL   Submitted (08-FEB-1999) to the EMBL/GenBank/DDBJ databases.
RL   Buck K.W., Biology, Imperial College of Science, Technology and Medicine,
RL   Imperial College Road, London, SW7 2AZ, UNITED KINGDOM.
XX
RN   [3]
RA   Hong Y., Dover S.L., Cole T.E., Brasier C.M., Buck K.W.;
RT   "Multiple mitochondrial viruses in an isolate of the Dutch elm disease
RT   fungus Ophiostoma novo-ulmi";
RL   Virology 258:118-127(1999).
XX
DR   GOA; Q9WJ24; Q9WJ24.
DR   SPTREMBL; Q9WJ24; Q9WJ24.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2343
FT                   /db_xref="taxon:88389"
FT                   /virion
FT                   /organism="Ophiostoma novo-ulmi mitovirus 6-Ld"
FT   CDS             142. .2229
FT                   /db_xref="GOA:Q9WJ24"
FT                   /db_xref="SPTREMBL:Q9WJ24"
FT                   /transl_table=4
FT                   /gene="pol6"
FT                   /product="RNA-dependent RNA polymerase, putative"
FT                   /protein_id="CAB42654.1"
FT                   /translation="MKLKQLKLMKNKTYQIIRILLIVFFPSIKRQTVILNIFMSKINKM
FT                   IKNNGTLFTVKYLKELRLHITKYISGEPYRNSLNRVSVDKDGFPTLCKELKVLVNGTYL
FT                   EKRFVLTIITLSKLLIPQKSESIPFSTKSITDHWSGIDNISNEELDKSCSELNISTREV
FT                   QWDVKNFKLLTKAGPHGPQSLTWYHTIKLYDFNQWLGIIGILPKSVLDLFTETLSYASK
FT                   LVLPEIKSNIKSTKLIRRLSIVHDPECKERVIAIFDYGSQMVLKPIADVLFDLLRNIPS
FT                   DRTFTQSPFFTHTDLDNKSKFWSIDLSSATDRFPIVFQKRVLQKILGKQMTDSWERIMI
FT                   GSKFLAPDGDTVSYNCGQPMGAQSSWPMFTLAHHVIVRVAANRCGLSNFDKYIILGDDI
FT                   VINNDNVALKYMEIMNDFKVEISRNKTHVSNDTYEFAKRWIKNKMEFFPLPIRGIVDNI
FT                   NNKYIIFNILYSFFVEKGNTFLNKDTLLVCVSKFIQLHSLTLKKPIGLNKVKGILYPFN
FT                   FMLRYRQNLCTNEEIRIFLGSSTCKRDDYMLPISAKDVSLELTRVISAALVGMAYNAEK
FT                   SLKNIYFDLDKLSPWIGDGFKTGKHPKVMIQSIYNSVKSLSDFGLKMAQNKLTLSAAMD
FT                   SLLLVDLDSISSSERIKYIQMKQNICLSQKVRKELRFDPLQMEQKARAMMLVKHMKDLE
FT                   G"
XX
SQ   Sequence 2343 BP; 881 A; 326 C; 360 G; 776 T; 0 other;

AJ132756  Length: 2343  January 14, 2003 16:47  Type: N  Check: 9650  ..

       1  actatccctt ttacaaggga tagctgagtt ttggaaaact ctcatgtacg
      51  aatgtacatg accgcaagaa aaagatagtc ctacattacg gagttcttta
     101  ccttttaatc ggcaactcac gacagtgacg aatgtcaagt aatgaaactt
     151  aaacaattaa aattaatgaa aaataaaaca tatcaaataa taagaatatt
     201  attgattgtc ttttttccat caattaaacg tcaaactgtt attttaaaca
     251  tttttatgag taaaatcaat aaaatgatta aaaataatgg tactttattt
     301  acagtgaagt atcttaagga attaagactc cacattacta agtatatttc
     351  gggagaacca tatcggaact ctctaaatag agttagtgta gataaagatg
     401  gatttccaac attatgtaag gaacttaaag ttttagttaa tggaacttat
     451  ctcgaaaaga gatttgttct aacaattatt actctaagta aattactaat
     501  tcctcaaaaa tctgaatcta taccttttag tactaaatca ataactgatc
     551  attgatctgg aattgataat atatctaatg aagaacttga taagtcatgt
     601  tctgaattaa atataagtac tagagaagtt cagtgagatg ttaagaactt
     651  caagttatta acaaaagctg gacctcatgg tcctcaatca ttaacttgat
     701  atcatacaat taaattatat gatttcaatc aatgattagg gatcataggt
     751  atattgccca aatctgtact tgatttattt actgaaactc tatcttacgc
     801  aagtaagtta gtgttaccag aaattaaatc taatattaaa tcaactaagt
     851  taattagaag attaagtatt gtacatgatc cagaatgtaa agaaagagtt
     901  attgccatat ttgattatgg atcacaaatg gtattaaaac caattgctga
     951  tgtattattc gatttactaa gaaatattcc tagtgatcgg acatttacac
    1001  aatcaccctt ctttacacat actgacttag ataacaaatc taagttttga
    1051  tcaattgatc tgtcttctgc aactgataga tttcctatag tattccaaaa
    1101  aagagtatta cagaaaatct taggtaaaca gatgacagat tcttgagaaa
    1151  gaataatgat tggatctaaa ttcctagctc ctgatggtga tacagttagt
    1201  tataactgtg gtcaaccaat gggagcacaa tcatcatgac caatgtttac
    1251  tctagctcat cacgtaattg tgagagttgc agcaaataga tgtggtttat
    1301  caaactttga taagtacatc atattaggag atgacattgt tattaataat
    1351  gacaatgttg ctctaaaata tatggaaata atgaatgatt ttaaagttga
    1401  aatatctaga aacaaaacac atgtatcaaa tgatacatat gaatttgcaa
    1451  aaagatggat caaaaataaa atggaatttt ttccattgcc aataagagga
    1501  atagttgata atataaataa taaatatatt atttttaata tcctctattc
    1551  attctttgtt gagaaaggta ataccttcct taataaggat actcttcttg
    1601  tttgtgtaag taaatttata caattgcatt ctttaactct taagaaacca
    1651  attggtttaa ataaggttaa agggatttta tatccattta actttatgct
    1701  tagatataga caaaatctat gtacaaatga agaaataaga atatttcttg
    1751  gttcttctac ttgtaaaaga gatgactata tgttacctat aagtgctaaa
    1801  gatgttagcc tagaattaac tagggtaatc tctgctgcac tagttggtat
    1851  ggcttataat gctgaaaaat cacttaagaa catttacttt gatcttgata
    1901  aattatcacc atggattggt gatggtttca agactggtaa acatcctaag
    1951  gtgatgattc aatcaattta taatagtgtt aaatctttat ccgacttcgg
    2001  attaaagatg gcacaaaata aattgacatt atcagcagca atggattcac
    2051  tattactagt ggatttagat tccatttctt cttcagaacg tataaaatat
    2101  atacaaatga agcagaacat atgcttaagc cagaaagttc gtaaagaact
    2151  tcgttttgat ccattacaaa tggaacaaaa ggcaagagct atgatgttag
    2201  tcaaacatat gaaagatcta gaaggttaaa atccaacgtt caattgctta
    2251  aagcaatcaa accaatacat tgtattggcg gcattattac ttaataatgt
    2301  cctattcaat gaataggagg ctatcccttg aaaaagggat agt