Sequence of DPV Pothos latent virus

Pothos latent virus complete genome, pigeonpea strain

ACC No: AJ243370

Dated: 2005-04-15 | Length: 4354 | CRC: 1370075319

                !!NA_SEQUENCE 1.0
ID   PLA243370  standard; genomic RNA; VRL; 4354 BP.
XX
AC   AJ243370;
XX
SV   AJ243370.1
XX
DT   28-OCT-1999 (Rel. 61, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Pothos latent virus complete genome, pigeonpea strain
XX
KW   complete genome.
XX
OS   Pothos latent virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Aureusvirus.
XX
RN   [1]
RP   1-4354
RA   Lava Kumar P.;
RT   ;
RL   Submitted (28-JUN-1999) to the EMBL/GenBank/DDBJ databases.
RL   Lava Kumar P., Virology (GREP), Icrisat, Patancheru, Andhra Pradesh,
RL   502324, INDIA.
XX
RN   [2]
RA   Lava Kumar P., Jones A.T., Sreenivasulu P., Fenton B., Reddy D.V.R.;
RT   " Characterization of a virus from pigeonpea with affinities to species in
RT   the genus Aureusvirus, family Tombusviridae.";
RL   Plant Dis. 85:208-215(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4354
FT                   /country="India:Andhra Pradesh"
FT                   /db_xref="taxon:44562"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Pothos latent virus"
FT                   /strain="pigeonpea"
FT   CDS             125. .793
FT                   /db_xref="UniProt/TrEMBL:Q9QBU4"
FT                   /note="ORF1"
FT                   /product="hypothetical protein, 25K"
FT                   /protein_id="CAB59792.1"
FT                   /translation="MANWCMSVLMFSFVTVYTIVTSLGQGIRRGFRAIVDEVENIYGDM
FT                   CAGFKVALSKLSVSWIVVVGMIFVLNSLVVGLVPTLTMVAIIAACVGAKYGGRVPRYIR
FT                   AHVDRIRKSWEKGVDDDDCCAPLPETSLERVPTKLRPRLACKIAVRAIAKVGLLKRSEA
FT                   NSMVYQRVCLDVMESMKMRWHDRLVILPQAVLACLERPEEVEEVMKAIEASCKGRFDVY
FT                   "
FT   CDS             125. .2344
FT                   /db_xref="GOA:Q9IWA0"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9IWA0"
FT                   /note="ORF2"
FT                   /note="read through stop codon"
FT                   /transl_except=(pos:791. .793,aa:OTHER)
FT                   /product="hypothetical protein, 84K"
FT                   /protein_id="CAB59793.1"
FT                   /translation="MANWCMSVLMFSFVTVYTIVTSLGQGIRRGFRAIVDEVENIYGDM
FT                   CAGFKVALSKLSVSWIVVVGMIFVLNSLVVGLVPTLTMVAIIAACVGAKYGGRVPRYIR
FT                   AHVDRIRKSWEKGVDDDDCCAPLPETSLERVPTKLRPRLACKIAVRAIAKVGLLKRSEA
FT                   NSMVYQRVCLDVMESMKMRWHDRLVILPQAVLACLERPEEVEEVMKAIEASCKGRFDVY
FT                   XGCLLQHRGYNTAIISAIPDGVLLNHEGMVVRKGAPITTERKWYSFAGYASTYEYIVHN
FT                   SSLVNVCRGLVERVFCVVRDGKLQRPLRPKNNVFERKLGNVGRRISSIVGYCPAMTRSE
FT                   FCESYSGTRRATYERARLSLDVLPCTRKDAYLKTFVKAEKINITLKPDPAPRVIQPRDP
FT                   RYNVEVGRYLKPLEPRLMKAIDKLWGEKTAIKGYTVEKVGEILHQKSLRFKNPCFVGLD
FT                   ASRFDQHCSRQALEWEHSVYNAIFRDPYLSELLTWQIDNVGTAYLKDGFVRYRVDGCRM
FT                   SGDMNTSMGNYLIMSCLVYQFCKDIGIDASLANCGDDCVLYLEKEDLPKLKALPDWFGK
FT                   MGYSMKVEKPVFTVEEIEFCQQHPVQLSRGYVMVRRPDVCLTKDLCVVRGGMTTERLQR
FT                   WLYAQHDGGLALTGDCPVLGAFYRRFPSGESHGELSEYSDAHKFKAGKQYGEINSLARY
FT                   SFWLAFGITPDEQLAIERDLMNWTPNVVPGSCDPRPTLLDYCSDN"
FT   CDS             2356. .3474
FT                   /db_xref="GOA:Q9QBU3"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9QBU3"
FT                   /note="ORF3"
FT                   /product="hypothetical protein, 41K"
FT                   /protein_id="CAB59794.1"
FT                   /translation="MALVKRNNNMALIATEAGKLAAVKAGQVMLSPAGRELIWNGVNWV
FT                   RRKLGRSKKSDVILHPGVLPGAIAAPVANTRIIRASKPKFTRSKGSVTIAHRELLGQFN
FT                   NSSGLVVNGGVSGNLYRINPSNPVVFPWLQGIAASFDQYKFDRVQLQYVPMCATTETGR
FT                   VAIYFDKDQQDVEPADRVELANMGHWTESAPWCESTLNVPVDNVKRFMNDNTTTDRKLV
FT                   DLGQIGLATYGGGSTNPVGDLFIHYTITLFEPQPLASLVETEQSGAGAAPFGTNLVTVS
FT                   SNATTTIITFRGPGVYLLALSQRAASFTTLVTAGGAVVNSHTTLFSGPAYQSIANITAT
FT                   IPGGSITYNGTLFGNYTLQVTRAKISNNATLI"
FT   CDS             3569. .4297
FT                   /db_xref="GOA:Q9QBU2"
FT                   /db_xref="InterPro:IPR005332"
FT                   /db_xref="UniProt/TrEMBL:Q9QBU2"
FT                   /note="ORF4"
FT                   /product="hypothetical protein, 27K"
FT                   /protein_id="CAB59795.1"
FT                   /translation="MEIQSLDGVLGEELAIQNEVKKILLSHKTTKAILPLAPISQFSKW
FT                   KIPKQGFYAPIDVKFVLTPHISERAQVRGVVKLVDSRDLSPSRELYRSKEFNIGHGLVI
FT                   EGSQLPFCLPVGDYPLQFEVTVLQSQFRETANLYSTSVEWRMMSSTTPLSRVRSVMGAA
FT                   QQPAMKLQPNFKMSLESSKGGGMKPHQKKSSKPNGHSRRGNLSGEVGGSSSSLPSGAQT
FT                   GEWIDNDYGDGSSEYSGVST"
FT   CDS             3700. .4092
FT                   /db_xref="UniProt/TrEMBL:Q9QBU1"
FT                   /note="ORF5"
FT                   /product="hypothetical protein, 14K"
FT                   /protein_id="CAB59796.1"
FT                   /translation="MENSQTGVLCPNRCQVCSHTTYIRESSGQGGRQACRFTRFVTQPR
FT                   VVSEQGIQYRSWLSDRGFPATLLSTSGGLSTTIRGHGVAVTIQGDSKSLLNFCRVAYDV
FT                   FHHPVVQSEVCHGSGPATSDEITTKF"
XX
SQ   Sequence 4354 BP; 1119 A; 929 C; 1132 G; 1174 T; 0 other;

 AJ243370  Length: 4354  April 19, 2005 08:53  Type: N  Check: 1053  ..

       1  gcctaaccag cttgttgaga gttgtggagc catccatata gttattctct
      51  cgcgcgattt taattgtgtg ggtttgaagg accagtctat cactttgtga
     101  ggataaattg taactgtggt caaaatggca aactggtgta tgagtgttct
     151  tatgttttct ttcgttactg tctacacgat tgtgacttcc cttgggcagg
     201  gcatcagacg tggctttcgg gccattgtcg atgaagttga gaacatctat
     251  ggggacatgt gtgctggatt caaggttgct ttaagcaagc ttagtgtctc
     301  ctggatagtt gttgtgggca tgatatttgt tcttaatagt ctcgtggttg
     351  gcctcgtccc caccctaacc atggttgcta ttatagcagc ctgtgttggg
     401  gcaaagtatg ggggtcgtgt cccacgatac attcgggccc atgtggatag
     451  aatacgaaaa tcttgggaaa aaggggtgga tgatgatgat tgctgcgctc
     501  cattacctga gacttctctc gagagggtgc ccactaagct gcggcctaga
     551  ctagcttgca agattgctgt cagggctata gccaaagtgg gattacttaa
     601  gaggagtgag gccaactcta tggtttacca aagggtgtgc ctagatgtta
     651  tggagagcat gaagatgcgt tggcacgaca ggcttgtcat cctccctcaa
     701  gcagttcttg cttgccttga gaggccagag gaagttgagg aagtcatgaa
     751  ggccatcgaa gcgtcctgta aggggcgctt tgatgtctac taggggtgcc
     801  tattacaaca ccgtggttat aacactgcta tcattagcgc cataccagat
     851  ggagtgttat tgaatcacga agggatggtg gtacgtaaag gagcccctat
     901  caccactgag cgaaaatggt actcattcgc tggatatgcc agcacttacg
     951  agtacattgt gcacaattct tcactcgtca acgtttgtcg tggtttggtt
    1001  gaacgagtat tttgcgtcgt gcgagacggt aaattgcagc gacctctgcg
    1051  ccccaagaat aatgtttttg agaggaagct tggtaatgtt ggtcgtagaa
    1101  tcagctcaat cgtcgggtac tgccccgcta tgacacgcag tgaattctgt
    1151  gaatcttata gcggcacgcg acgcgccacg tatgaacgag ctagattgtc
    1201  cttggatgtt ctcccctgta cccgcaaaga tgcttatctg aaaactttcg
    1251  ttaaggcgga gaagatcaat attacactca aacccgaccc cgcaccccgg
    1301  gtcattcagc cacgtgaccc taggtacaat gtggaagtgg gacgttactt
    1351  gaagcctctt gaacccagat tgatgaaggc cattgataaa ttatgggggg
    1401  aaaagacggc gattaaggga tacacagtcg agaaggttgg ggagatctta
    1451  caccagaaat cacttaggtt taagaatcca tgctttgttg gtcttgacgc
    1501  ctcacgtttc gatcagcact gttccaggca agcacttgag tgggaacact
    1551  cagtgtataa cgctatcttc agggatcctt acttatccga actattgact
    1601  tggcagattg acaatgttgg cactgcttat ctgaaggatg ggtttgttag
    1651  gtatcgtgtt gatggctgcc gtatgtctgg ggacatgaac accagcatgg
    1701  gtaattacct tataatgtct tgtttggtct accagttttg taaagatatt
    1751  ggcatcgacg ctagtcttgc caactgcggt gacgattgtg tactttattt
    1801  ggagaaagag gacctcccta agctgaaggc attacccgat tggtttggaa
    1851  agatggggta ttccatgaaa gtggagaaac ctgttttcac tgtcgaagag
    1901  atcgagtttt gccaacaaca cccagtacag cttagcagag gttatgttat
    1951  ggtcagacgg ccagatgtct gcttgacaaa ggatttgtgc gttgtccgtg
    2001  gaggcatgac aacggagaga ctccagcgat ggttatatgc ccaacatgat
    2051  ggtggattag cccttacggg tgattgtccc gtgttgggag ccttttaccg
    2101  acgtttcccc agtggtgagt cccatgggga gttgtctgaa tattctgacg
    2151  cacataaatt taaggccggt aagcagtatg gagaaatcaa cagtctcgct
    2201  cgttatagtt tttggttggc attcggtatt acaccggatg aacaactcgc
    2251  tattgaacgt gacctgatga attggactcc caacgtggtt cctggatctt
    2301  gtgatccaag gcccacgttg ttggactact gctcagataa ctgaccatta
    2351  tcatcatggc gctcgtaaaa cgaaataata atatggcgtt aattgcaacg
    2401  gaagcaggga agttagcagc tgtaaaagcc ggacaagtta tgcttagtcc
    2451  agcaggaaga gagttgattt ggaatggtgt gaattgggtt cgcaggaagt
    2501  tggggagatc caagaagtct gatgttattc ttcacccagg tgttttacca
    2551  ggtgccattg ctgcgcctgt agctaatacc cgaatcatta gagcatccaa
    2601  gcctaaattt acacgaagca agggatcggt gaccattgcc caccgtgagt
    2651  tattgggaca atttaataac tcctcagggc ttgttgtgaa tgggggcgtt
    2701  tctggcaatt tatacaggat caatcctagt aatccagtcg tctttccatg
    2751  gttgcagggt atagccgcca gttttgatca atacaagttc gatagggtac
    2801  agctacaata tgttcccatg tgtgccacca ctgagacggg cagagtagcc
    2851  atctacttcg ataaggatca acaagatgtt gaacctgcag accgggtaga
    2901  gttagctaat atgggtcatt ggacagaaag tgcaccatgg tgcgagagca
    2951  ccctaaatgt acctgttgac aacgtaaagc ggtttatgaa tgacaacacc
    3001  acaactgatc ggaagctcgt ggatcttgga caaattgggt tagcaacata
    3051  tgggggagga agtacaaatc ctgtcggtga tcttttcata cattatacga
    3101  ttactttgtt tgaaccacag ccattagcta gtttagttga gacagagcaa
    3151  tccggtgcgg gtgcggctcc ttttggaacc aatcttgtga cggtctcaag
    3201  taatgcaacg acaaccatta ttacctttag aggtccaggt gtctatctgc
    3251  tagctttgtc acaacgggct gcctcattca ccacgcttgt cactgctggt
    3301  ggggctgttg tcaattctca cacaacgctg ttctctggac cagcgtacca
    3351  atcaattgca aacattactg ctactatacc tggggggtcc ataacgtaca
    3401  atggtacgct gttcggcaac tacactctcc aggtcacccg ggctaaaatt
    3451  tccaacaacg cgactttgat atgagtgacc atgtttgggt acgaacgtag
    3501  gacggaggag tgatacctgg caatgtctgg gttgaccact tagtggctta
    3551  agaagtctga ccagctttat ggaaatacaa tctcttgacg gagtactggg
    3601  tgaagaactt gccatacaga acgaagtcaa gaaaatactg ttgagtcata
    3651  aaactaccaa agccatacta ccactagcac ccatctcaca attctctaaa
    3701  tggaaaattc ccaaacaggg gttctatgcc ccaatagatg tcaagtttgt
    3751  tctcacacca catatatcag agagagctca ggtcaggggg gtcgtcaagc
    3801  ttgtcgattc acgcgatttg tcacccagcc gcgagttgta tcggagcaag
    3851  gaattcaata tcggtcatgg cttagtgatc gagggttccc agctaccctt
    3901  ctgtctacca gtgggggact atccactaca attcgaggtc acggtgttgc
    3951  agtcacaatt cagggagaca gcaaatctct actcaacttc tgtcgagtgg
    4001  cgtatgatgt cttccaccac cccgttgtcc agagtgaggt ctgtcatggg
    4051  agcggcccag caaccagcga tgaaattaca accaaatttt aagatgtcgt
    4101  tggaatcatc caagggcggt ggcatgaagc cacatcagaa gaaaagcagt
    4151  aaacctaatg gccatagtcg gaggggtaat ctatctgggg aagttggtgg
    4201  ttcttcttcc tccctgccct caggtgcaca aactggggag tggatagata
    4251  atgattatgg agacggttcg tctgagtact ctggtgtgtc tacatagcac
    4301  accccaggtg tcataccctg aaatttagta aggggggcta taaatgacgc
    4351  ttgg