Sequence of DPV Tomato bushy stunt virus

tomato bushy stunt virus mRNA for hypothetical protein (ORF3)

ACC No: AJ271328

Dated: 2005-04-15 | Length: 1167 | CRC: -1208082482

                !!NA_SEQUENCE 1.0
ID   TBU271328  standard; mRNA; VRL; 1167 BP.
XX
AC   AJ271328;
XX
SV   AJ271328.1
XX
DT   19-JAN-2000 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   tomato bushy stunt virus mRNA for hypothetical protein (ORF3)
XX
KW   ORF3.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1167
RA   Russo M.;
RT   ;
RL   Submitted (16-JAN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Russo M., Centro Studi Virus Virosi Colture Mediterranee, Consiglio
RL   Nazionale delle Ricerche, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [3]
RA   Galetzka D., Russo M., Rubino L., Krczal G.;
RT   "Molecular characterization of a tombusvirus associated wiyh a disease of
RT   statice (Goniolimon tataricum (L.) Boiss.)";
RL   J. Plant Pathol. 82:151-155(2000).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1167
FT                   /country="Italy"
FT                   /db_xref="taxon:12145"
FT                   /mol_type="mRNA"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="BS3"
FT   CDS             1. .1167
FT                   /db_xref="GOA:Q9IW10"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9IW10"
FT                   /evidence=EXPERIMENTAL
FT                   /note="ORF3"
FT                   /protein_id="CAB66390.1"
FT                   /translation="MAMTTRNNNNVLAISKKQLGVLAASAAVGALRNHISESSPALLQS
FT                   AVGLGKKALNKVRNRRKQGNQQIITHVGGVGGSIMAPVAVSRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLTQVNNSSGFVVNGGIVGNLLQLNPSNGTLFSWLPAIASNFDQYSFNSVVLH
FT                   YVPLCGTTEVGRVALYFDKDSQDPEPADRVELANFGVLKETAPWAEAMLRIPTDKVKRY
FT                   CNDSATVDQKLIDLGQLGIATYGGAGTNAVGDVFISYSVTLYFPQPTNTLLSTRRLDLT
FT                   GSLADATGPGYLVLTRTPTVLTHTFRVTGTFNLSGGLRCLTSLTLGATGAVVINDILAI
FT                   DNVGTASAYFLNCTVSSLPATVTFTTTGISSATVNVVRGTRANVVNLL"
XX
SQ   Sequence 1167 BP; 302 A; 256 C; 299 G; 310 T; 0 other;

 AJ271328  Length: 1167  April 19, 2005 08:50  Type: N  Check: 3038  ..

       1  atggcgatga caacgagaaa taacaacaat gtgctcgcta taagcaagaa
      51  acagttgggg gtcctagcag catctgctgc tgtgggggct ctgcgtaatc
     101  atattagtga gagtagcccg gcactgctgc aatcggcagt gggtttggga
     151  aagaaggctt tgaataaggt gaggaatcgg aggaaacagg gaaatcagca
     201  gatcattact catgtaggcg gcgtcggggg ttcaatcatg gcccctgtgg
     251  cagtgtccag gcagctagta ggtagtaagc cgaaatttac cggaaggaca
     301  tctggatctg tcacagttac gcaccgtgag tatcttacac aagtaaacaa
     351  ttcttcagga tttgtagtga atgggggtat tgtcggcaat ttgttacaac
     401  tcaacccgtc aaatggaaca ctgttctcat ggttgcctgc catagcatcc
     451  aattttgatc agtactcatt taacagcgtt gtgttacatt atgtccccct
     501  atgcggtact actgaagttg ggcgtgtggc gctatacttt gacaaggact
     551  cacaagatcc tgaacctgct gatagagtgg agttggcgaa cttcggtgtt
     601  ctaaaggaga cagccccttg ggctgaggca atgctgcgca tacccactga
     651  caaagtaaag agatactgta atgacagtgc tacagttgat cagaaactta
     701  tagatttggg acagcttggt attgctactt acggaggggc aggtacaaac
     751  gctgtagggg atgtgttcat ctcctatagt gttacattgt actttcctca
     801  acccaccaac accctgttaa gtacacgacg gcttgacctc accggatctt
     851  tggctgatgc tacgggacct gggtaccttg tactgacaag aacgcctacg
     901  gtcttaacgc acacatttag ggtaactggc acttttaacc tctccggagg
     951  gttgaggtgt ttaaccagtc tcactctcgg agcgacgggg gctgtggtta
    1001  ttaatgatat acttgcaatt gataatgtcg gtacggctag tgcctacttc
    1051  ctcaattgca cagtatcctc tctaccagcc accgtcacat ttactacaac
    1101  tgggatatca tctgccactg ttaatgtggt gcgtggcaca cgcgctaatg
    1151  ttgttaattt actataa