Sequence of DPV Lettuce necrotic stunt virus

Lettuce necrotic stunt virus partial p19 gene for 19 kDa protein, isolate L1, genomic RNA

ACC No: AJ288915

Dated: 2005-04-15 | Length: 844 | CRC: -775986879

                !!NA_SEQUENCE 1.0
ID   TBU288915  standard; genomic RNA; VRL; 844 BP.
XX
AC   AJ288915;
XX
SV   AJ288915.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Lettuce necrotic stunt virus partial p19 gene for 19 kDa protein, isolate
DE   L1, genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Lettuce necrotic stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-844
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [2]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .844
FT                   /country="USA:Salinas, California, mid-1980s"
FT                   /db_xref="taxon:167947"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Lettuce necrotic stunt virus"
FT                   /strain="Lettuce"
FT                   /isolate="L1"
FT                   /tissue_type="leaf"
FT                   /specific_host="Lactuca sativa"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .519
FT                   /db_xref="GOA:Q9ICR9"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q9ICR9"
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01256.1"
FT                   /translation="MERAIQGNDAREQANSERWNGGSGGSTSPFKFPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTEASLHRVLGSWTGDSVNYAASRFFG
FT                   INQIGCTYSIRFRGVSVTISGGSRALQHLCEMAVWAKQELLQLTPVEVESNVSRRCPEG
FT                   FEAFEKESE"
XX
SQ   Sequence 844 BP; 226 A; 163 C; 239 G; 216 T; 0 other;

 AJ288915  Length: 844  April 19, 2005 08:49  Type: N  Check: 2092  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttggaat ggaggatcag gaggtagcac ttctcccttc aaatttcctg
     101  acgaaagtcc gagttggact gagtggaggc tacataacga tgagacgaat
     151  tcgaatcagg ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga cgggacggaa gcttcattgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtatcaacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt gtcaccattt ctggagggtc gagagctctt cagcatctct
     401  gtgagatggc agtttgggct aagcaagaat tgctacagct taccccagtc
     451  gaagtggaaa gtaatgtatc aagaagatgc cctgaaggtt ttgaagcctt
     501  cgaaaaagaa agcgagtaag acagactctt ctgtctgatt gagtggaagc
     551  aagtactaac ctagattgca tgtgggttac ttgcactggc atgcagccgt
     601  tatgatgacg agtcaggtcg ggctccgcgg tgggtttggt cgcccatggg
     651  acggagatat ggaaagggtc tcgtacgctg taagactaac ttcggttgag
     701  cttgcgatat gggcctatgc ctggataagt cataatgtta ctgcccagtg
     751  taaattggat gccaacttac aaccttagga gtacttgtgg aacctcatga
     801  tgacacggtt gatctcaccc ttcggggggg ctatagagat cgct