Sequence of DPV Cucumber necrosis virus

Cucumber necrosis virus partial p19 gene for 19 kDa protein, isolate L4, genomic RNA

ACC No: AJ288919

Dated: 2005-04-15 | Length: 830 | CRC: 1982624754

                !!NA_SEQUENCE 1.0
ID   CNE288919  standard; genomic RNA; VRL; 830 BP.
XX
AC   AJ288919;
XX
SV   AJ288919.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Cucumber necrosis virus partial p19 gene for 19 kDa protein, isolate L4,
DE   genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Cucumber necrosis virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-830
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [3]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .830
FT                   /country="USA:Chualar, California, 1998"
FT                   /db_xref="taxon:12143"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Cucumber necrosis virus"
FT                   /strain="Lettuce"
FT                   /isolate="L4"
FT                   /tissue_type="leaf"
FT                   /specific_host="Lactuca sativa"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .522
FT                   /db_xref="GOA:Q9IES9"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q9IES9"
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01089.1"
FT                   /translation="MERAIQGSDAREQAYSERWDGGCGGTITPFKLPDESPSLHEWRLH
FT                   NSEESEDKDHPLGFKESWSFGKVVFKRYLRYDGTETSLHRALGSWERSTVNDAASRFLG
FT                   FGQIGCTYSIRFRGSCLTLSGGSRTLQRLIEMAIRTKYTMLQLTPSEVEGDVSRGCPEG
FT                   SEAFKTKESE"
XX
SQ   Sequence 830 BP; 217 A; 166 C; 237 G; 210 T; 0 other;

 AJ288919  Length: 830  April 19, 2005 08:49  Type: N  Check: 4916  ..

       1  atggaacgag ctatacaagg aagcgacgct agggaacaag cttacagtga
      51  acgttgggat ggaggatgtg gaggtaccat tactcccttc aaacttcctg
     101  acgaaagtcc gagtctccat gagtggaggc tacataacag tgaggagagt
     151  gaggataaag atcatcccct tggtttcaag gaaagctgga gtttcgggaa
     201  ggttgtattt aagagatatc tcagatacga cgggacggag acttcactgc
     251  acagagctct tggatcttgg gagagaagta cggttaacga tgcagcatct
     301  agatttctcg gtttcggcca gatcggatgt acctatagta ttcggtttcg
     351  aggatcttgt ctcaccctat ctggagggtc gcgaactctt cagcgtctca
     401  ttgagatggc aattcggact aagtacacaa tgttacagct tacccccagc
     451  gaagtggaag gtgatgtatc aagaggatgc cctgaaggtt ctgaagcctt
     501  caaaacaaaa gaaagcgagt aagacaggct cttcagtctg acttggtgga
     551  aacttacgaa tttaactgtt actctacatg ggttccttcc catgcgatga
     601  cgagtcaggt cgggccctat cttaggtttg gtcacctagg gaacggggat
     651  atggaaagca ctttcgcttg ctgtcagtct agtgggaaca ctgagcttgc
     701  aatgtgggtg tatgcctgga taagttgcat ggatgctggc catgatgaat
     751  tggatgcagt ttaggacgta tagtggaagc cttgccagac acggttgatc
     801  tcacccttcg ggggggctat agagatcgct