Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate L8C, genomic RNA

ACC No: AJ288925

Dated: 2005-04-15 | Length: 848 | CRC: 159408133

                !!NA_SEQUENCE 1.0
ID   TBU288925  standard; genomic RNA; VRL; 848 BP.
XX
AC   AJ288925;
XX
SV   AJ288925.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate L8C,
DE   genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-848
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [3]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .848
FT                   /country="USA:Yuma, Arizona, 1999"
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="Cherry"
FT                   /isolate="L8C"
FT                   /tissue_type="leaf"
FT                   /specific_host="Lactuca sativa"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .570
FT                   /db_xref="GOA:Q9ICR5"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q9ICR5"
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01262.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESSVSRGCPEG
FT                   TQTFEKRRRVRQTLQSEFVEMSVNLA"
XX
SQ   Sequence 848 BP; 224 A; 169 C; 244 G; 211 T; 0 other;

 AJ288925  Length: 848  April 19, 2005 08:49  Type: N  Check: 8507  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttgggat ggaggatcag gaggtaccac ttctcccttc aaacttcctg
     101  acgaaagtcc gagttggact gagtggcggc tacataacga tgagacgaat
     151  tcgaatcaag ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga caggacggaa gcttcactgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtttcgacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt atcaccgttt ctggagggtc gcgaactctt cagcatctct
     401  gtgagatggc aattcggtct aagcaggaac tgctacagct tgccccaatc
     451  gaagtggaaa gtagtgtatc aagaggatgc cctgaaggta ctcaaacctt
     501  cgaaaaaaga aggcgagtaa gacagactct tcagtctgag tttgtggaga
     551  tgagtgtaaa tctggcatag catacaggtt actcttgttg ggttctggat
     601  gttaggatga cgagtcgact cgggctccgc actaggtttg gtcgcctagg
     651  ggatggagat gtggaaaggg tctcgtgtgg tatcagtcgg tcgaaagacg
     701  cgcatccaac atgggcctat ggtcggataa gtcttagcaa taccagccag
     751  catgaattgg attcctgttt acgaaagtta ggtgtcactt gtggaagcgg
     801  acccagacac ggttgatctc acccttcggg ggggctatag agatcgct