Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate To1, genomic RNA

ACC No: AJ288926

Dated: 2005-04-15 | Length: 566 | CRC: 1420428098

                !!NA_SEQUENCE 1.0
ID   TBU288926  standard; genomic RNA; VRL; 566 BP.
XX
AC   AJ288926;
XX
SV   AJ288926.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate To1,
DE   genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-566
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [3]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .566
FT                   /country="USA:Colorado, greenhouse, 1998"
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="Lettuce"
FT                   /isolate="To1"
FT                   /tissue_type="inflorescence"
FT                   /specific_host="Lycopersicon esculentum"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .552
FT                   /db_xref="GOA:Q9ICR4"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q9ICR4"
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01263.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGCPEG
FT                   TQTFEQEGEYDRLFSLSLWR"
XX
SQ   Sequence 566 BP; 160 A; 112 C; 153 G; 141 T; 0 other;

  AJ288926  Length: 566  April 19, 2005 08:56  Type: N  Check: 533  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttgggat ggaggatctg gaggtaccac ttctcccttc aaacttcctg
     101  acgaaagtcc gagttggact gagtggcggc tacataacga tgagacgaat
     151  tcgaatcaag ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga caggacggaa gcttcactgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtttcgacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt atcaccgttt ctggagggtc gcgaactctt cagcatctct
     401  gtgagatggc aattcggtct aagcaagaac tgctacagct tgccccaatc
     451  gaagtggaaa gtaatgtatc aagaggatgc cctgaaggta ctcaaacctt
     501  cgaacaagaa ggcgagtatg acagactctt cagtctgagt ttgtggagat
     551  gagtgtaaat ctggca