Sequence of DPV Lettuce necrotic stunt virus

Lettuce necrotic stunt virus partial p19 gene for 19 kDa protein, isolate To3E, genomic RNA

ACC No: AJ288933

Dated: 2005-04-15 | Length: 843 | CRC: -1472089051

                !!NA_SEQUENCE 1.0
ID   TBU288933  standard; genomic RNA; VRL; 843 BP.
XX
AC   AJ288933;
XX
SV   AJ288933.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Lettuce necrotic stunt virus partial p19 gene for 19 kDa protein, isolate
DE   To3E, genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Lettuce necrotic stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-843
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [3]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .843
FT                   /country="USA:New Mexico, greenhouse, 1999"
FT                   /db_xref="taxon:167947"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Lettuce necrotic stunt virus"
FT                   /strain="Lettuce"
FT                   /isolate="To3E"
FT                   /tissue_type="inflorescence"
FT                   /specific_host="Lycopersicon esculentum"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .519
FT                   /db_xref="GOA:Q9ICQ8"
FT                   /db_xref="HSSP:1R9F"
FT                   /db_xref="InterPro:IPR004905"
FT                   /db_xref="UniProt/TrEMBL:Q9ICQ8"
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01269.1"
FT                   /translation="MERAIQGNDAREQANSERWNGGSGGSTSPFKFSDESPSWTERRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTEASLHRVLGSWTGDSVNYAASRFFG
FT                   INQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAVRAKQELLQLTPVEVESNVSRRCPEG
FT                   FKTFEEESE"
XX
SQ   Sequence 843 BP; 231 A; 166 C; 236 G; 210 T; 0 other;

 AJ288933  Length: 843  April 19, 2005 08:49  Type: N  Check: 5057  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttggaat ggaggatcag gaggtagcac ttctcccttc aaattttctg
     101  acgaaagtcc gagttggact gagaggaggc tacataacga tgagacgaat
     151  tcgaatcagg ataaccccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga cgggacggaa gcttcattgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtatcaacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt gtcaccattt ctggagggtc gagaactctt cagcatctct
     401  gtgagatggc agttcgggct aagcaagaat tgctacagct taccccggtc
     451  gaagtggaaa gtaatgtatc aagaagatgc cctgaaggtt ttaaaacctt
     501  cgaagaagaa agcgagtaag acagactctt cagtctgatt gagtggaagc
     551  aagcactaac ctagatagca tgtgggttac ttgcgctggc atgcagccgt
     601  tatgatgacg agtcaggtcg ggctctacgg tgggtttggt cgcccatggg
     651  acggagatat ggaaagggtc tcgtacgctg taagactaac ttcggttgag
     701  cttgcgatat gggcctatgc ctggataagt cataacgtta ctgcccagtg
     751  taaattggat accaacttac aaccctagga gtacttgtgg aacctcatga
     801  tgacacggtt gatctcaccc ttcggggggc tatagagatc gct