Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate EP1, genomic RNA

ACC No: AJ288945

Dated: 2001-07-26 | Length: 847 | CRC: -1054602298

                !!NA_SEQUENCE 1.0
ID   TBU288945  standard; RNA; VRL; 847 BP.
XX
AC   AJ288945;
XX
SV   AJ288945.1
XX
DT   01-AUG-2000 (Rel. 64, Created)
DT   26-JUL-2001 (Rel. 68, Last updated, Version 2)
XX
DE   Tomato bushy stunt virus partial p19 gene for 19 kDa protein, isolate EP1,
DE   genomic RNA
XX
KW   19 kDa protein; P19 gene.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-847
RA   Obermeier C.;
RT   ;
RL   Submitted (12-APR-2000) to the EMBL/GenBank/DDBJ databases.
RL   Obermeier C., Agricultural Research Service, United States Department of
RL   Agriculture, 1636 E. Alisal St., Salinas, CA 93905, USA.
XX
RN   [3]
RA   Obermeier C., Sears J.L., Liu H.Y., Schlueter K.O., Ryder E.J.,
RA   Duffus J.E., Koike S.T., Wisler G.C.;
RT   "Characterization of distinct tombusviruses that cause diseases of lettuce
RT   and tomato in the Western United States";
RL   Phytopathology 91:797-806(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .847
FT                   /country="USA:Fresno, California, 1998"
FT                   /db_xref="taxon:12145"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="Cherry"
FT                   /isolate="EP1"
FT                   /tissue_type="leaf"
FT                   /specific_host="Solanum melongena"
FT                   /lab_host="Nicotiana clevelandii"
FT   CDS             <1. .519
FT                   /gene="p19"
FT                   /product="19 kDa protein"
FT                   /protein_id="CAC01281.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGCPEG
FT                   TQTFEKEGE"
XX
SQ   Sequence 847 BP; 226 A; 169 C; 241 G; 211 T; 0 other;

AJ288945  Length: 847  December 21, 2001 15:40  Type: N  Check: 3100  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttgggat ggaggatcag gaggtaccac ttctcccttc aaacttcctg
     101  acgaaagtcc gagttggact gagtggcggc tacataacga tgagacgaat
     151  tcgaatcaag ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga caggacggaa gcttcactgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtttcgacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt atcaccgttt ctggagggtc gcgaactctt cagcatctct
     401  gtgagatggc aattcggtct aagcaagaac tgctacagct tgccccaatc
     451  gaagtggaaa gtaatgtatc aagaggatgc cctgaaggta ctcaaacctt
     501  cgaaaaagaa ggcgagtaag acagactctt cagtctgagt ttgtggagat
     551  gagtgtaaat ctggcatagc atacaggtta ctcttgttgg gttctggatg
     601  ttaggatgac gagtcgactc gggctccgca ctaggtttgg tcgcctaggg
     651  gatggagata tggaaagggt ctcgtgtggt atcagtcggt cgaaagacgc
     701  gcatccaaca tgggcctatg gtcggataag tcttagcaat accagccagc
     751  atgaattgga ttcctgttta cgaaagttag gtgtcacttg tggaagcgga
     801  cccagacacg gttgatctca cccttcgggg gggctataga gatcgct