Sequence of DPV Citrus tristeza virus

Citrus tristeza virus genomic RNA for p23 protein

ACC No: AJ298843

Dated: 2001-01-05 | Length: 630 | CRC: -1063177604

                !!NA_SEQUENCE 1.0
ID   CTR298843  standard; genomic RNA; VRL; 630 BP.
XX
AC   AJ298843;
XX
SV   AJ298843.1
XX
DT   05-JAN-2001 (Rel. 66, Created)
DT   05-JAN-2001 (Rel. 66, Last updated, Version 1)
XX
DE   Citrus tristeza virus genomic RNA for p23 protein
XX
KW   p23 gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Connor R.K.;
RT   ;
RL   Submitted (05-OCT-2000) to the EMBL/GenBank/DDBJ databases.
RL   Connor R.K., Plant Protection, NSW Agriculture, PMB 8, Camden, NSW 2570,
RL   AUSTRALIA.
XX
RN   [2]
RA   Zhou C., Connor R., Broadbent P., Bowyer J., Hailstones D.;
RT   "Molecular and Biological Characterisation of the Citrus Tristeza Virus
RT   isolate used in Australia to protect grapefruit against severe tristeza
RT   stem pitting.";
RL   Unpublished.
XX
RN   [3]
RA   Connor R.;
RT   ;
RL   Thesis (2001), University of Sydney
XX
DR   TrEMBL; Q9DJS8; Q9DJS8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /country="Australia:NSW"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="PB61"
FT                   /specific_host="Citrus paradisi cv Marsh (grapefruit)"
FT                   /lab_host="Symons sweet orange"
FT   CDS             1. .630
FT                   /db_xref="TrEMBL:Q9DJS8"
FT                   /gene="p23"
FT                   /product="p23 protein"
FT                   /function="unknown"
FT                   /protein_id="CAC19956.1"
FT                   /translation="MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTASAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 187 A; 127 C; 163 G; 153 T; 0 other;

 AJ298843  Length: 630  April 14, 2004 15:32  Type: N  Check: 8794  ..

       1  atgaacgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagcacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatccct taattattga cgctctggtg
     151  cggaaaacca attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  atgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaaata tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgtacacc aaggaaaagc
     401  aattggcggt tgatttggcc gccgaaaggg agaagacgag gttggctcgt
     451  agacacccaa tgcgttctcc agaggaaact ccggaacatt ataaattcgg
     501  tatgaccgct tcagcgatgt taccggaact caacgctgta ggcgttggtg
     551  ataacgaaga cacttcgtcg gagtacccag taagtctgag tgtttccggt
     601  ggagttctcc gtgaacacca cttcatctga