Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate Col

ACC No: AJ309493

Dated: 2005-04-15 | Length: 1382 | CRC: 1385867843

                !!NA_SEQUENCE 1.0
ID   CMO309493  standard; genomic RNA; VRL; 1382 BP.
XX
AC   AJ309493;
XX
SV   AJ309493.1
XX
DT   30-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
DE   Col
XX
KW   coat protein; cp gene; movement protein; p7 gene; P9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1382
RA   Pallas V.;
RT   ;
RL   Submitted (26-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Pallas V., Biologia del estres, Instituto de Biologia Molecular y Celular
RL   de Plantas-CSIC, Avenida de los Naranjos s/n, 46022 Valencia, SPAIN.
XX
RN   [3]
RX   DOI; 10.1007/s007050170051.
RX   MEDLINE; 21578632.
RX   PUBMED; 11722023.
RA   Canizares M.C., Marcos J.F., Pallas V.;
RT   "Molecular varaibility of twenty-one geographically distinct isolates of
RT   Carnation mottle virus (CarMV) and phylogenetic relationships within the
RT   Tombusviridae family";
RL   Arch. Virol. 146(10):2039-2051(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1382
FT                   /country="Colombia"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Col"
FT   CDS             1. .186
FT                   /db_xref="GOA:Q98VJ0"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q98VJ0"
FT                   /note="The central region contains an RNA-binding motif"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAC27459.1"
FT                   /translation="MDIEPEVPVVGKQTLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             92. .346
FT                   /db_xref="UniProt/TrEMBL:Q98VK4"
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAC27460.1"
FT                   /translation="MPSANLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             336. .1382
FT                   /db_xref="GOA:Q98VH4"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q98VH4"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAC27461.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   ATTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1382 BP; 399 A; 315 C; 360 G; 308 T; 0 other;

 AJ309493  Length: 1382  April 19, 2005 08:56  Type: N  Check: 4007  ..

       1  atggatattg aaccggaagt accagtagtt ggaaagcaaa cgctcgctgg
      51  gaatagggga aaacagaaga cacgtagatc ggtggccaag gatgccatcc
     101  gcaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct
     151  gataagattg aggtgcacat tcacttcaac ttttagtttg cccccactgg
     201  taactttaaa tcagataata gcgttgtcat tttgtggtct tctattaaac
     251  agcatctctc gggcagaaag agcttgctat tacaactact ctgttgatag
     301  ttctaagcaa caacacattt caataagtac accaaatgga aaataaagga
     351  gaaaagatcg cgatgaatcc cactgtgcaa acattggcgc agaaggggga
     401  caagttggcc gtgaagttgg tgacaagagg gtgggcctct ctgagtacga
     451  accagaagag gagagctgaa atgcttgctg gatacactcc agcgatccta
     501  gcctttacac cccgacgacc acggatgaca aaccctcctc caagaaccag
     551  taggaattca ccaggacaag ctggaaagtc catgacgatg agtaagaccg
     601  aattattaag caccgtcaag ggtaccacgg gtgttatccc aagctttgaa
     651  gactgggtcg tttccccccg aaacgtagcc gtcttccctc aactctcgct
     701  gctggcgacg aacttcaaca agtaccgcat tactgcgctc actgtgaagt
     751  actcacccgc gtgcagcttc gagaccaatg ggagggtggc tctgggattc
     801  aacgatgacg cttcggacac accggcaacc accaaggttg gtttttacga
     851  tctgggtaaa catgtggaga ctgctgcaca gacagccaaa gatctagtga
     901  taccagtcga cggcaaaacc cggttcatca gggactcggc tagtgatgat
     951  gccaaactag tcgattttgg acgaatagtc ttgtcaacat acgggtttga
    1001  caaggctgac actgtggtgg gcgaattgtt tatacagtac acgattgtgc
    1051  tgagtgaccc aaccaagacg gccaaaattt cacaggcaag caacgataag
    1101  gtgtcggacg gaccaacgta tgtggtccct tcggttaatg gcaacgagct
    1151  acaactaaga gtggtagccg ctgggaaatg gtgcatcata gtgcggggta
    1201  cggttgaggg aggcttcacc aaacccacac ttattgggcc aggcatcagc
    1251  ggtgatgtgg actatgaaag tgccagacct atcgccgttt gtgaattggt
    1301  gacacaaatg gagggccaga tattgaatat caccaagacc tcagcagaac
    1351  aaccactcca atgggttgtt tataggatgt ga