Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate sp-s

ACC No: AJ309510

Dated: 2005-04-15 | Length: 1382 | CRC: 1197773925

                !!NA_SEQUENCE 1.0
ID   CMO309510  standard; genomic RNA; VRL; 1382 BP.
XX
AC   AJ309510;
XX
SV   AJ309510.1
XX
DT   30-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
DE   sp-s
XX
KW   coat protein; cp gene; movement protein; p7 gene; P9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1382
RA   Pallas V.;
RT   ;
RL   Submitted (29-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Pallas V., Biologia del estres, Instituto de Biologia Molecular y Celular
RL   de Plantas-CSIC, Avenida de los Naranjos s/n, 46022 Valencia, SPAIN.
XX
RN   [4]
RX   DOI; 10.1007/s007050170051.
RX   MEDLINE; 21578632.
RX   PUBMED; 11722023.
RA   Canizares M.C., Marcos J.F., Pallas V.;
RT   "Molecular varaibility of twenty-one geographically distinct isolates of
RT   Carnation mottle virus (CarMV) and phylogenetic relationships within the
RT   Tombusviridae family";
RL   Arch. Virol. 146(10):2039-2051(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1382
FT                   /country="Spain"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="sp-s"
FT                   /variety="Scania"
FT   CDS             1. .186
FT                   /db_xref="GOA:Q999Z3"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q999Z3"
FT                   /note="The central region contains an RNA-binding motif"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAC27507.1"
FT                   /translation="MDIEPEVPVAEKQALAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             92. .346
FT                   /db_xref="UniProt/TrEMBL:Q999Z2"
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAC27508.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRADRACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             336. .1382
FT                   /db_xref="GOA:Q999Z1"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q999Z1"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAC27509.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELRLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGNVDYESARPIAICELVTQMEGQMLHITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1382 BP; 403 A; 315 C; 355 G; 309 T; 0 other;

 AJ309510  Length: 1382  April 19, 2005 08:56  Type: N  Check: 5647  ..

       1  atggatattg aaccggaagt accagtagct gagaagcaag cgctcgctgg
      51  aaatagggga aaacaaaaga cacgtagatc ggtggccaag gatgccatcc
     101  gtaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct
     151  gataagattg aggtgcacat tcacttcaac ttttagtttg cccccactgg
     201  taactttaaa tcagataata gcgttgtcat tttgtggtct tctattgaac
     251  agcatctctc gggcagatag agcttgctat tacaactact ctgttgatag
     301  ttccaaacaa caacacattt cgattagtac accaaatgga aaataaagga
     351  gaaaagatcg cgatgaatcc cactgtgcaa acattggcgc agaaggggga
     401  caagttagcc gtgaagttgg tgacaagagg atgggcctct ctgagtacga
     451  accagaagag gagagctgaa atgcttgctg gatacactcc agcgatccta
     501  gccttcacac cccgacgacc acggatgacg aaccctcctc caagaaccag
     551  taggaattca ccaggacaag ctggaaagtc catgacgatg agtaagaccg
     601  aactactatg caccgtcaaa ggtaccacgg gtgttatccc aagctttgaa
     651  gactgggtcg tttccccccg aaacgtagcc gttttccctc aactctcgct
     701  gctggcgacg aacttcaata agtaccgcat cactgcgctt actgtgaagt
     751  actcaccggc gtgtagcttc gagactaatg ggagggtggc tctgggattc
     801  aacgatgacg cttcggacac accaccaacc accaaggttg gcttttacga
     851  tctgggcaaa catgtggaaa ctgctgcaca gacagctaaa gatctagtga
     901  taccagtaga cggcaaaacc cggttcatca gggactcggc tagtgatgat
     951  gccaaactag tcgattttgg acgaatagtc ttgtcaacat acgggtttga
    1001  caaggctgac actgtggtgg gcgaattgtt tatacagtac acgattgtgc
    1051  taagtgaccc aaccaagacg gccaaaattt cacaggcaag taacgataag
    1101  gtgtcggatg gaccaacgta tgtggtccct tcggtcaatg gcaacgagct
    1151  gcgactaaga gtggtggccg ctgggaaatg gtgcatcata gtgcggggaa
    1201  cggtcgaagg aggcttcacc aaacccacac ttgttgggcc aggaatcagt
    1251  ggtaatgtgg actatgaaag tgccagacct atcgccattt gtgaattggt
    1301  gacacaaatg gagggccaaa tgttacacat caccaagacc tcagcagaac
    1351  aaccactcca atgggttgtt tataggatgt ga