Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate usa-1

ACC No: AJ309511

Dated: 2005-04-15 | Length: 1382 | CRC: -1277318254

                !!NA_SEQUENCE 1.0
ID   CMO309511  standard; genomic RNA; VRL; 1382 BP.
XX
AC   AJ309511;
XX
SV   AJ309511.1
XX
DT   30-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
DE   usa-1
XX
KW   coat protein; cp gene; movement protein; p7 gene; P9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1382
RA   Pallas V.;
RT   ;
RL   Submitted (29-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Pallas V., Biologia del estres, Instituto de Biologia Molecular y Celular
RL   de Plantas-CSIC, Avenida de los Naranjos s/n, 46022 Valencia, SPAIN.
XX
RN   [4]
RX   DOI; 10.1007/s007050170051.
RX   MEDLINE; 21578632.
RX   PUBMED; 11722023.
RA   Canizares M.C., Marcos J.F., Pallas V.;
RT   "Molecular varaibility of twenty-one geographically distinct isolates of
RT   Carnation mottle virus (CarMV) and phylogenetic relationships within the
RT   Tombusviridae family";
RL   Arch. Virol. 146(10):2039-2051(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1382
FT                   /country="USA"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="usa-1"
FT                   /variety="894MFJ"
FT   CDS             1. .186
FT                   /db_xref="GOA:Q9DJV4"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q9DJV4"
FT                   /note="The central region contains an RNA-binding motif"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAC27510.1"
FT                   /translation="MDIESEVPVVEKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             92. .346
FT                   /db_xref="UniProt/TrEMBL:Q999Z0"
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAC27511.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGR"
FT   CDS             336. .1382
FT                   /db_xref="GOA:Q999Y9"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q999Y9"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAC27512.1"
FT                   /translation="MEDKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTAKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDGAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICVLVTQMEGQILKITKTSAGQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1382 BP; 400 A; 316 C; 360 G; 306 T; 0 other;

 AJ309511  Length: 1382  April 19, 2005 08:56  Type: N  Check: 4537  ..

       1  atggatattg aatcggaagt accagtagtt gaaaagcaaa tgctcgctgg
      51  gaacagagga aaacaaaaga cacgtagatc ggtggccaag gatgccatcc
     101  gtaaacctgc atctgatagt actaacgggg gtaattgggt taatgttgct
     151  gataagattg aggtgcacat tcacttcaac ttttagtttg cccccactgg
     201  taactttaaa tcagataata gcgttgtcat tttgcggtct tctgttaaac
     251  agcatctctc gggcagaaag agcgtgctat tacaactact ctgttgatag
     301  ttctaaacaa caacacattt cgataagtac accaaatgga agataaagga
     351  gaaaagatcg cgatgaatcc cactgtgcaa acattggcgc agaaggggga
     401  caagttagcc gtgaagttgg tgacaagggg ttgggcctct ctgagtacga
     451  accagaagag gagagctgaa atgcttgctg gatacactcc agcgatccta
     501  gccttcacac cccgacgacc acggatgacg aaccctcctc caagaaccag
     551  taggaattca ccaggacaag ctggaaagtc catgacgatg agtaagaccg
     601  aactattaag caccgtcaaa ggtaccaccg gtgttatccc gagctttgaa
     651  gactgggtcg tttccccccg aaacgtagcc gtcttccctc aactctcgct
     701  gctggcgacg aacttcaaca agtaccgcat tactgcgctc actgcgaagt
     751  actcacccgc gtgcagcttc gagaccaatg ggagggtggc tctgggattc
     801  aacgatgacg cttcggatac accaccaacc accaaggttg gattttacga
     851  tctgggcaaa catgtggaaa ctgctgcaca gacagctaag gatctagtga
     901  taccagtaga cggcaaaacc cggttcatca gggactcggc tagtgatggt
     951  gccaaactag tcgattttgg acggatagtc ttgtcaacat acgggtttga
    1001  caaggctgac actgtggtgg gcgaattatt catacagtac acgattgtgc
    1051  tgagtgaccc aaccaagacg gccaaaattt cacaggcaag caacgataag
    1101  gtgtcggacg gaccaacgta tgtggtccct tcggttaatg gcaacgagct
    1151  acaactaaga gtggtagccg ctgggaaatg gtgcattata gtgcggggta
    1201  cggttgaggg aggcttcacc aaacccacac ttattgggcc gggaatcagc
    1251  ggtgatgtgg actatgaaag tgccagacct atcgccattt gtgtgttggt
    1301  gacacaaatg gagggccaga tattgaaaat caccaagacc tcagcaggac
    1351  aaccactcca atgggttgtt tataggatgt ga