Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus CP gene for coat protein, genomic RNA

ACC No: AJ312281

Dated: 2005-04-15 | Length: 1386 | CRC: -1494949955

                !!NA_SEQUENCE 1.0
ID   TBU312281  standard; genomic RNA; VRL; 1386 BP.
XX
AC   AJ312281;
XX
SV   AJ312281.1
XX
DT   20-SEP-2001 (Rel. 69, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Tomato bushy stunt virus CP gene for coat protein, genomic RNA
XX
KW   coat protein; cp gene.
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1386
RA   Grieco F.;
RT   ;
RL   Submitted (08-JUN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Grieco F., c/o Dip Prot. Piante e Micr. Appl., Centro Studio Virus e Virosi
RL   Colt Medit, via Amendola n.165/A, Italy 70126, ITALY.
XX
RN   [2]
RA   Grieco F., Vovlas C.;
RT   "First report of tomato bushy stunt in Greece";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1386
FT                   /country="Greece"
FT                   /db_xref="taxon:12145"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Tomato bushy stunt virus"
FT                   /strain="glauca"
FT   CDS             73. .1239
FT                   /db_xref="GOA:Q911S0"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q911S0"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAC79221.1"
FT                   /translation="MAMVKRNNNTGMVLATPKQLLALGAAAGATALQGFVRSNGAAFVE
FT                   GVVDVGKRVYKAVKRRGGKKQQLINHVGGTGGAIMAPVAVTRQLVGSKPKFTGRTSGSV
FT                   TVTHREYLSQVNNSTGFQVNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYTFNNVVLH
FT                   YVPLCATTEVGRVAIYFDKDSEDPEPADRVELANYSVLKETAPWAEAMLRVPTDKIKRF
FT                   CDDSSTLDHKLIDLGQLGVATYGGAGTNAVGDLFISYSVTLYFPQPTNTLLSTRRLDLA
FT                   GTLVTASGPGYILLSRTPTVLTMTFRATGTFVVSGAYRCLTATVLGLAGGVNVNSITVV
FT                   DNIGTDSAFFINCTVSNLPSVITFTTTGITSATVHCNRATRQNDVSLV"
XX
SQ   Sequence 1386 BP; 379 A; 294 C; 355 G; 358 T; 0 other;

 AJ312281  Length: 1386  April 19, 2005 08:50  Type: N  Check: 4871  ..

       1  tgacgctcat gagcccagca tcctcgactc cgccgtagct tgaccaagat
      51  tacacagaca cgggactaag atatggcaat ggtaaagaga aacaataaca
     101  ccggaatggt gttggcaacg ccgaagcagt tactggcatt gggtgcggcc
     151  gcgggggcaa ctgccctgca gggatttgtg agaagtaatg gagcagcttt
     201  cgttgaggga gttgttgatg ttggaaagag agtgtacaaa gcagtgaaaa
     251  ggcgaggagg taagaaacag cagttgatta atcatgtagg gggtacaggt
     301  ggggctatta tggccccggt tgcagtcaca agacaacttg tcggcagtaa
     351  gcctaaattt accggcagga cgtctggttc tgtaacagtt acccaccgtg
     401  agtatctatc acaagtgaat aattccacag gattccaagt taatggggga
     451  attgtcggca atttgttaca gctcaacccg ttgaatggta ctttgttctc
     501  atggttgccc gcgatagcgt ccaactttga tcagtacact ttcaacaatg
     551  ttgtgctaca ttatgtcccc ctatgtgcaa ccaccgaggt ggggagagtg
     601  gccatttact ttgacaagga ctcggaagat cctgaacctg ctgatagagt
     651  tgagttggcg aattacagcg ttctcaaaga gacagcccct tgggctgaag
     701  caatgctcag ggttcctacc gataagatta agagattttg tgatgacagt
     751  tctacattag atcacaaact tatcgattta ggacaattgg gtgtagctac
     801  atatggtggc gctggaacta acgctgtggg ggatttattt atctcataca
     851  gtgtgacgtt atatttccct caacctacaa atactctcct tagcactaga
     901  aggcttgatc tcgctggaac actcgtcaca gcatctggtc ctgggtatat
     951  tttattatct aggactccta cagtactcac tatgactttc cgtgctactg
    1001  gcacgtttgt cgtctctgga gcttatcgtt gtttaaccgc aacagtgctc
    1051  ggcttggcag gtggggtgaa tgtgaatagt atcactgtgg tggacaatat
    1101  aggaacggat agtgcatttt tcataaattg cactgtgtct aacctaccgt
    1151  ccgtgatcac tttcaccacc actggcataa catcagccac agtacactgc
    1201  aatcgtgcga cacgacagaa tgatgtttct ctagtttaga tagtcctgtg
    1251  aggggcctct tgaacaagac cagtccatgg atactgaata cgaacaagtc
    1301  aataaaccat ggaacgagct atacaaggaa acgacgctag ggaacaagct
    1351  aatggtgaac gttgggatgg aggatcagga aatcac