Sequence of DPV Citrus tristeza virus

Citrus Tristeza Virus cp gene for coat protein, genomic RNA, isolate CTV-0001

ACC No: AJ518840

Dated: 2006-09-13 | Length: 672 | CRC: 1514403297

                
ID   AJ518840; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   AJ518840;
XX
DT   07-JAN-2006 (Rel. 86, Created)
DT   13-SEP-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Citrus Tristeza Virus cp gene for coat protein, genomic RNA, isolate
DE   CTV-0001
XX
KW   coat protein; cp gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barbarossa L.;
RT   ;
RL   Submitted (22-NOV-2002) to the EMBL/GenBank/DDBJ databases.
RL   Barbarossa L., Dip. Protezione delle Piante e M.A., Istituto di Virologia
RL   Vegetale-Sez. Bari, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [2]
RA   Barbarossa L., Savino V.;
RT   "Sensitive and specific digoxigenin-labelled RNA probes for routine
RT   detection of Citrus tristeza virus by dot-blot Hybridisation";
RL   J. Phytopathol. 154(6):329-335(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CTV-0001"
FT                   /mol_type="mRNA"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2PDK1"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2PDK1"
FT                   /protein_id="CAD57675.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAEEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 189 A; 121 C; 179 G; 183 T; 0 other;

aj518840 Length: 672  13-SEP-2006  Type: N  Check: 3670  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagggatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg agagggcgtc gaagtggaat tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctga agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  cgggaaattt aacacacgtt ga