Sequence of DPV Citrus tristeza virus

Citrus Tristeza Virus cp gene for coat protein, genomic RNA, isolate CTV-0002

ACC No: AJ518841

Dated: 2006-09-13 | Length: 672 | CRC: -982148166

                
ID   AJ518841; SV 1; linear; mRNA; STD; VRL; 672 BP.
XX
AC   AJ518841;
XX
DT   07-JAN-2006 (Rel. 86, Created)
DT   13-SEP-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Citrus Tristeza Virus cp gene for coat protein, genomic RNA, isolate
DE   CTV-0002
XX
KW   coat protein; cp gene.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Barbarossa L.;
RT   ;
RL   Submitted (22-NOV-2002) to the EMBL/GenBank/DDBJ databases.
RL   Barbarossa L., Dip. Protezione delle Piante e M.A., Istituto di Virologia
RL   Vegetale-Sez. Bari, Via Amendola 165/A, 70126 Bari, ITALY.
XX
RN   [2]
RA   Barbarossa L., Savino V.;
RT   "Sensitive and specific digoxigenin-labelled RNA probes for routine
RT   detection of Citrus tristeza virus by dot-blot Hybridisation";
RL   J. Phytopathol. 154(6):329-335(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CTV-0002"
FT                   /mol_type="mRNA"
FT                   /country="China"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2PDK0"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q2PDK0"
FT                   /protein_id="CAD57676.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 121 C; 176 G; 184 T; 0 other;

aj518841 Length: 672  13-SEP-2006  Type: N  Check: 5119  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtgcta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga