Sequence of DPV Carnation mottle virus

Carnation mottle virus partial coat protein, genomic RNA

ACC No: AJ549954

Dated: 2003-05-28 | Length: 1047 | CRC: 667523819

                !!NA_SEQUENCE 1.0
ID   CMO549954  standard; RNA; VRL; 1047 BP.
XX
AC   AJ549954;
XX
SV   AJ549954.2
XX
DT   13-MAR-2003 (Rel. 75, Created)
DT   28-MAY-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Carnation mottle virus partial coat protein, genomic RNA
XX
KW   coat protein.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RC   revised by [3]
RA   Singh H.P.;
RT   ;
RL   Submitted (13-MAR-2003) to the EMBL/GenBank/DDBJ databases.
RL   Singh H.P., Floriculture Division, IHBT(CSIR), P.O.Box No. 6, Palampur.
RL   Distt. Kangra, Himachal Pradesh - 176 061, INDIA.
XX
RN   [2]
RA   Singh H.P., Hallan V., Sharma M.L., Kulshrestha S., Raikhy G., Verma R.R.,
RA   Zaidi A.A.;
RT   "Detection and molecular characterization of Indian strain of Carnation
RT   mottle virus (CarMV) infecting Carnation";
RL   Unpublished.
XX
RN   [3]
RP   1-1047
RA   Singh H.P.;
RT   ;
RL   Submitted (27-MAY-2003) to the EMBL/GenBank/DDBJ databases.
RL   Singh H.P., Floriculture Division, IHBT(CSIR), P.O.Box No. 6, Palampur.
RL   Distt. Kangra, Himachal Pradesh - 176 061, INDIA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /clone="CarMV cp"
FT                   /strain="Indian"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .1047
FT                   /product="coat protein"
FT                   /protein_id="CAD71267.2"
FT                   /translation="MENKGEKIAMNPTVQALAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLAMNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KANTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGR
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 299 A; 249 C; 282 G; 217 T; 0 other;

  AJ549954  Length: 1047  June 3, 2003 09:56  Type: N  Check: 792  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaagcatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct cgctgggtac
     151  actccagcgg tcctagcctt cacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagcaa gaccgaacta ttatgcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgcttg cgatgaactt caacaagtac cgcattactg
     401  cgctcactgt gaagtactca cccgcgtgca gcttcgagac caatgggagg
     451  gtggctctag gattcaacga tgacgcttcg gatacaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ctaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttgggcgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctaacactgt ggtgggcgaa ttgttcatac
     701  agtacacgat agtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg agatggtgca
     851  ttatagtgcg gggtacggtt gaaggaggct tcaccaaacc cacacttatt
     901  gggccgggaa ttagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgaa ttggtgacac aaatggaggg ccagatattg aatatcacca
    1001  aaacctcagc agaacaacca ctccaatggg ttgtttatag gatgtga