Sequence of DPV Johnsongrass chlorotic stripe mosaic virus

Johnsongrass chlorotic stripe mosaic virus ORF1, CP gene, p24 gene and p15 gene, genomic RNA

ACC No: AJ557804

Dated: 2003-08-30 | Length: 4421 | CRC: -839369030

                !!NA_SEQUENCE 1.0
ID   JCH557804  standard; genomic RNA; VRL; 4421 BP.
XX
AC   AJ557804;
XX
SV   AJ557804.1
XX
DT   30-AUG-2003 (Rel. 77, Created)
DT   30-AUG-2003 (Rel. 77, Last updated, Version 1)
XX
DE   Johnsongrass chlorotic stripe mosaic virus ORF1, CP gene, p24 gene and p15
DE   gene, genomic RNA
XX
KW   coat protein; CP gene; movement protein; ORF1; p15 gene; p24 gene;
KW   replicase.
XX
OS   Johnsongrass chlorotic stripe mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Aureusvirus.
XX
RN   [1]
RP   1-4421
RA   Winter S.;
RT   ;
RL   Submitted (28-APR-2003) to the EMBL/GenBank/DDBJ databases.
RL   Winter S., Plant Virus Division, DSMZ, Messeweg 11/12, Braunschweig 38104 ,
RL   GERMANY.
XX
RN   [2]
RA   Koohi Habibi M., Winter S., Koerbler M., Arbabi M., Izadpanah K.;
RT   "Johnsongrass chlorotic stripe mosaic virus, a new member of the genus
RT   Areusvirus";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4421
FT                   /country="Iran"
FT                   /db_xref="taxon:229149"
FT                   /mol_type="genomic RNA"
FT                   /note="Tombusviridae, genus Aureusvirus"
FT                   /virion
FT                   /organism="Johnsongrass chlorotic stripe mosaic virus"
FT   CDS             45. .2432
FT                   /note="contains readthrough stop codon"
FT                   /transl_except=(pos:861. .863,aa:OTHER)
FT                   /transl_table=1
FT                   /product="replicase"
FT                   /protein_id="CAD89890.1"
FT                   /translation="MDTGILSRRIVTAEVDFQFGSVDYSDPRIVHALCTPGLKERATFG
FT                   RQIVTALKMAVIALTLPVWWPLRLVWRVIIMGVLWVTRFXTRCTNLIKWCVKETRVTVR
FT                   AYWNILNKRARGLVVLGCWASFVLYGPYALLLWLGVIVGYIICVLPSNVRYYIELGQKI
FT                   QDAWDSVEADDTIEAPCNGDILEVRKGRNKFACKLAARAIGRVGLLKATPANALVYQKV
FT                   ILDEMKILNVRFADRVRILPLAVMASLDRPDAVARVEDCVAALTQRGVSLXGGLVRREG
FT                   CDTTTDRTNFDLSAVKGVGPTEGLSVRAGTSAKGDRSWYSFNSLATTYEYVVHNGSLKN
FT                   VCRGLVERVFCVVDKQSGKLVRPPKPKPGVFSAKLGDVGRTVSSIVGYCPHWTRDEFVA
FT                   SYSGPRKASYERAAQTLDTLPLMESDAHLSTFVKAEKINVTLKPDPAPRVIQPRGQRYN
FT                   IEVGRFLKPLEPRLMKAIDKLWGSTTAIKGYTVEKVGSIFADKASRFRHPVYVGLDASR
FT                   FDQHCSADALRWEHSVYNDIFRSPYLAELLEWQVHNRGSAYTHEGKVNYRVEGCRMSGD
FT                   MNTSMGNYLIMSCLIYQFCKEIGLHAELANCGDDCVLFLEKHDLKKLKHLPQWFVKMGY
FT                   TMKVESPVYELEEVEFCQMHPVRTSRGWVMVRRPDTVMTKDCCVVRGGMTTERLRGWLG
FT                   AMRDGGLSLAGDVPVLSAFYSSFPQYRNGETSDYDAPHKFRAGKQYGAITAEARYSFWL
FT                   AFGLTPDDQLAIEGDLSSFKFSLEPQDLVTSMPSLLDYCTRT"
FT   CDS             45. .863
FT                   /note="ORF1"
FT                   /transl_table=1
FT                   /product="replicase"
FT                   /protein_id="CAD89891.1"
FT                   /translation="MDTGILSRRIVTAEVDFQFGSVDYSDPRIVHALCTPGLKERATFG
FT                   RQIVTALKMAVIALTLPVWWPLRLVWRVIIMGVLWVTRFXTRCTNLIKWCVKETRVTVR
FT                   AYWNILNKRARGLVVLGCWASFVLYGPYALLLWLGVIVGYIICVLPSNVRYYIELGQKI
FT                   QDAWDSVEADDTIEAPCNGDILEVRKGRNKFACKLAARAIGRVGLLKATPANALVYQKV
FT                   ILDEMKILNVRFADRVRILPLAVMASLDRPDAVARVEDCVAALTQRGVSL"
FT   CDS             2539. .3633
FT                   /evidence=EXPERIMENTAL
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAD89892.1"
FT                   /translation="MPPQAPTRLGNAWGRRCGTGGLGFQGAWNRLRKRMTNGGGVPMIV
FT                   GSGGGTVAAPVAVSRQIRSRKPKFTSVKGQVRVTHREYVTQVSGVGSGLFQLNGGLPSG
FT                   QFRVNPNNAACFPWLLSIASNFDQYRFVNLQLCYVPLCATTEVGRVALFYDKDSGDSGP
FT                   FERAELANMTHCAETPPWAEVSLTVPCDNVKRYLNDSNVTDLKLVDAGRFGYAVYGGNA
FT                   NTYGDLFIQYTVELSEPQPTAGLIGEVXGNAGTVAGVVQPAYFNFDGFSTTQVAFKPTV
FT                   VGTYLMTFILDGTGLVLGNVTSSAPEGMSVLDQNVAGSATRVIYVCRVTVQRPGDRLFF
FT                   NYTGTATFWNLFVVRATRDISITT"
FT   CDS             3672. .4325
FT                   /transl_table=1
FT                   /gene="p24"
FT                   /product="putative movement protein"
FT                   /protein_id="CAD89893.1"
FT                   /translation="MSIVNIDGEFEQPQFQDTPSKVYISHKSRKSLVCLGPSVFHKLWK
FT                   VPKTGFYTPTGVTFVVTPHISESAGVTAVIKLIDMSDMSPSRVLYKSKEFNLGHGLTLE
FT                   GSQLPFCLPIGEYPIHFEVTVSRSQFQATRTMFSTSLEWHLMYSPTPLSRVRSVFGVAH
FT                   QPVLEVETNFRMKTKQISSSVVAVLPKQKALGKGLKPVGGTTPGLVTGNCVGTD"
FT   CDS             3800. .4219
FT                   /transl_table=1
FT                   /gene="p15"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAD89894.1"
FT                   /translation="MEGPKDWVLHPHRCDFCGHATYLRECWRHGSDQVNRHERHEPFPR
FT                   LVQVQGVQPGTWPDIGRVTTAVLPANRGVSYTLRGHGVTITVSGHENDVFNVARVASDV
FT                   LTHPVIQGEICVRGSPPTGVGGGNQLPYENQTNIV"
XX
SQ   Sequence 4421 BP; 1004 A; 1070 C; 1257 G; 1087 T; 3 other;

AJ557804  Length: 4421  September 16, 2003 08:56  Type: N  Check: 3614  ..

       1  gagaatactg gcagtgattg accatcacgg tgagttgtcc agccatggat
      51  accggtattc tctcgcggcg catagtgact gctgaagttg actttcaatt
     101  tggttctgtt gactacagtg acccaagaat agtccacgca ttatgcaccc
     151  cgggtttgaa ggagcgggcg accttcgggc gtcaaattgt tactgcgctc
     201  aaaatggccg tcattgcact gacgttacct gtgtggtggc ccctcagact
     251  tgtctggagg gtcatcatca tgggagtgct gtgggtcacc aggttcwtca
     301  ctcggtgcac caacctcatc aaatggtgcg ttaaggagac gcgcgttacc
     351  gtgcgagctt attggaayat tctcaacaag cgtgccaggg ggttggttgt
     401  actgggttgt tgggcctcct ttgtgttgta tggtccctat gccttacttt
     451  tgtggctggg cgtgattgtt ggatacataa tttgtgtcct accgtctaat
     501  gtccgctact acattgagct gggccagaaa atacaggatg catgggactc
     551  tgtggaagcg gatgatacca tagaggctcc gtgtaatggt gatatcctgg
     601  aggttcgcaa gggacgcaat aagttcgctt gcaaactggc tgcccgggca
     651  attggtagag ttggcttgct gaaggccacc cctgctaatg ccctggtcta
     701  tcagaaagtg atcttggatg agatgaaaat cttaaatgtt cgctttgctg
     751  atcgagttag gattttgcca ttagcagtga tggctagtct tgacaggcca
     801  gacgccgtgg ctagggttga ggactgcgtg gcagccctca cccaacgcgg
     851  tgtgagcctc tagggaggcc tagtccgccg agagggttgt gacaccacca
     901  ctgaccgcac aaattttgat ttatcagcgg ttaaaggggt gggtcccaca
     951  gagggactct cggtgagggc tgggacctcg gccaagggtg atagaagttg
    1001  gtactccttc aactcactgg ccactacata tgagtacgtt gttcacaacg
    1051  gttccttgaa aaacgtgtgc agaggacttg tcgagcgggt cttctgtgtt
    1101  gtggacaagc aaagcgggaa attggtccgc cccccaaaac cgaagccggg
    1151  ggtcttttcc gctaagctcg gtgacgttgg tcgaactgtg agctcaatcg
    1201  ttggttattg cccccactgg acacgtgacg agtttgttgc gtcttacagt
    1251  gggccgcgaa aagcctcata cgagcgagct gcacagacgc tagacactct
    1301  acctctcatg gaaagtgatg cacacttgag cacctttgtg aaggcagaga
    1351  agatcaatgt cacgttgaag cccgacccgg ccccgcgtgt gatacaacca
    1401  cggggccagc gatataacat tgaggtcggg cggtttttga agcccctgga
    1451  accacgtctc atgaaggcga tagataaact gtggggatcc accacagcta
    1501  ttaaggggta tacggttgag aaggtcggct cgatctttgc agataaggct
    1551  tcaaggttta ggcacccggt ctatgttggg cttgatgctt cccgctttga
    1601  ccagcactgt agtgctgatg cgttaaggtg ggaacattct gtctacaatg
    1651  atatattccg ctcgccttac ttagccgagc tcctggaatg gcaggtccac
    1701  aatcgtgggt cagcctacac ccacgagggc aaggttaatt atagggtgga
    1751  ggggtgtcgg atgtctgggg acatgaacac ttccatggga aactatctga
    1801  ttatgtcatg tctcatatat cagttctgca aggaaatcgg gttgcacgcg
    1851  gagctagcaa actgtggtga tgattgtgtg ctattcctgg agaaacatga
    1901  tcttaagaag cttaagcact taccgcagtg gtttgttaaa atgggatata
    1951  ctatgaaggt tgaatcaccg gtgtacgaac ttgaggaagt tgaattctgt
    2001  cagatgcacc cggtgagaac ctctaggggg tgggtgatgg ttaggcggcc
    2051  tgacacggtc atgactaagg actgttgtgt cgtcagggga ggaatgacaa
    2101  cggagcggct gcgagggtgg ttgggtgcga tgagagatgg ggggttgagc
    2151  ctagccggcg atgttcctgt tctctcagcg ttttattctt cattccctca
    2201  ataccgcaac ggagaaacct ctgattatga tgcaccacac aagttcaggg
    2251  cgggtaagca gtatggtgct atcacggctg aggcacggta ttcattctgg
    2301  ctggcgttcg ggttaacacc tgatgatcag ctagctattg aaggggacct
    2351  ttcatccttc aagttttcac ttgaaccaca ggatttggtc acctccatgc
    2401  ccagcttact tgactactgc actagaacct gaccagttca ccctaacacg
    2451  atgtcgatcg tcccagcgaa tacgaacaga gccctagtgc gcgcaggcac
    2501  tgctcttgcc tcaggagcca tgacagccat ggttccctat gccgccgcag
    2551  gcgcccacca gattgggcaa cgcctgggga agaaggtgtg gaacgggtgg
    2601  gttgggtttc cagggggcct ggaaccgcct cagaaaaagg atgacgaacg
    2651  ggggaggagt tcccatgatt gttggaagtg gaggtgggac tgtggctgca
    2701  ccagtcgctg tatcccgcca aatccgcagc aggaagccga agttcacaag
    2751  tgtcaaaggt caagtgagag tgactcatcg tgagtatgtt acccaagtct
    2801  ccggggtggg ctccggattg ttccagctca atggaggatt gccatcaggc
    2851  cagtttaggg ttaacccaaa caatgctgcc tgcttcccgt ggttgctaag
    2901  catagcatcg aacttcgacc agtacagatt tgttaatctg cagctgtgtt
    2951  atgttccgct gtgcgccaca acggaggtgg ggcgagtggc tctcttctac
    3001  gacaaggaca gcggagatag tgggccgttt gagcgagctg agcttgccaa
    3051  catgacccat tgtgccgaaa caccaccatg ggcagaggta tcactcacag
    3101  ttccgtgcga caatgtcaag cggtacctga atgattccaa tgttactgac
    3151  cttaagctcg ttgacgccgg acggttcggt tacgcggtgt atgggggtaa
    3201  tgccaatacc tatggcgatc tcttcataca atacaccgta gaacttagtg
    3251  agccacagcc tacggctgga ctcattgggg aggtamctgg taatgccggt
    3301  acggtggcag gcgtcgtgca acctgcgtac ttcaactttg atggattctc
    3351  cacaacccaa gtagcattca agcctaccgt cgtgggtaca tatctcatga
    3401  cgttcatact tgacggcaca ggtctggtgt tgggcaatgt cacatcctct
    3451  gctcctgagg ggatgtctgt cctggaccag aatgtagcag gatcagccac
    3501  acgtgtcatc tatgtgtgca gggttaccgt ccagcggcca ggcgaccggt
    3551  tgttcttcaa ttacaccggc acagccacct tctggaactt attcgtggtg
    3601  cgtgctacga gagacatctc tatcaccacc tagtcgcgtc gtgcctgggg
    3651  gattagaagc tgaccacttc aatgtctatc gtcaatatcg acggtgagtt
    3701  tgagcagcct caattccagg ataccccttc gaaagtctac atttcccata
    3751  aatctcgcaa gtctctagtg tgcttggggc catctgtctt ccacaagtta
    3801  tggaaggtcc caaagactgg gttttacacc cccaccggtg tgacttttgt
    3851  ggtcacgcca catatctccg agagtgctgg cgtcacggca gtgatcaagt
    3901  taatcgacat gagcgacatg agcccttccc gcgtcttgta caagtccaag
    3951  gagttcaacc tgggacatgg cctgacattg gaagggtcac aactgccgtt
    4001  ttgcctgcca atcggggagt atcctataca cttcgaggtc acggtgtcac
    4051  gatcacagtt tcaggccacg agaacgatgt tttcaacgtc gctcgagtgg
    4101  catctgatgt actcacccac cccgttatcc agggtgagat ctgtgttcgg
    4151  ggtagcccac caaccggtgt tggaggtgga aaccaacttc cgtatgaaaa
    4201  ccaaacaaat atcgtctagc gtcgtcgctg tgttgccgaa gcagaaagcc
    4251  ctaggaaagg gcctaaagcc tgttggtggt acgactcctg gtttggtcac
    4301  cgggaactgc gtaggaacag actgaaggtc actagtactg gcactatggc
    4351  ggcataagcg acacacggag ccacacttcg gtggggctat aaggttccgt
    4401  gttgtatccc tcttactttc a