Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone 32-23-1

ACC No: AJ579766

Dated: 2003-12-04 | Length: 632 | CRC: 21381928

                !!NA_SEQUENCE 1.0
ID   CTR579766  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579766;
XX
SV   AJ579766.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone 32-23-1
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6E3; Q7T6E3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Spain"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="32-23-1"
FT                   /isolate="T-32"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6E3"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30348.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDTNAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 632 BP; 189 A; 125 C; 163 G; 155 T; 0 other;

 AJ579766  Length: 632  December 9, 2003 08:57  Type: N  Check: 377  ..

       1  atggatgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacacg gcaagcacta aagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggaatt tttacgtaaa atgaatccct ttattgttga cgctctggtg
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg caatctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaagta tttgaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgtacacc aaggaaaggc
     401  aattggcggt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccaa tacgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacac caacgccgta gacgttggtg
     551  ataacgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca tttcatctga tt