Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone K-23-3

ACC No: AJ579767

Dated: 2003-12-04 | Length: 632 | CRC: 1200197104

                !!NA_SEQUENCE 1.0
ID   CTR579767  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579767;
XX
SV   AJ579767.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone K-23-3
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6E2; Q7T6E2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="France:Corsica"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="K-23-3"
FT                   /isolate="K"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6E2"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30349.1"
FT                   /translation="MNDTSGQTFVSVNLSDESNTASTEVKTVSSEADRLEFLRKMNPFT
FT                   IDALIRKASYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGTTAKAMLPDVNAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 632 BP; 187 A; 128 C; 165 G; 152 T; 0 other;

AJ579767  Length: 632  December 9, 2003 08:57  Type: N  Check: 8908  ..

       1  atgaatgata ctagcggaca aactttcgtt tctgtgaacc tttccgacga
      51  aagcaacaca gcgagtaccg aagttaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacgaaaa atgaatccct ttactatcga cgctttgata
     151  cggaaagcca gttatcaggg tgctcgcttt cgcgccagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgcacacc aaggaaaggc
     401  aattggcggt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tacgactgct aaggcaatgt taccggacgt caacgccgta gacgttggtg
     551  ataacgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga tt