Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone 346-23-13

ACC No: AJ579768

Dated: 2003-12-04 | Length: 632 | CRC: -278448907

                !!NA_SEQUENCE 1.0
ID   CTR579768  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579768;
XX
SV   AJ579768.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone 346-23-13
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6E1; Q7T6E1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Spain"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="346-23-13"
FT                   /isolate="T-346"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6E1"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30350.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VRYLNKRKARAFSNAETFAIELVLYTKEKQLAVDLAAEREKARLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPEFNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 632 BP; 184 A; 125 C; 167 G; 156 T; 0 other;

 AJ579768  Length: 632  December 9, 2003 08:57  Type: N  Check: 332  ..

       1  atggacgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagtacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatccct tcattattga cgctctggtg
     151  cggaaaacta attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaggta tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag acgtttgcga ttgaattggt tttgtacacc aaggaaaagc
     401  aattggcggt tgatttggcc gccgaaaggg agaaggcgag gttggctcgt
     451  agacacccaa tgcgttctcc agaggaaact ccggaacatt acaaattcgg
     501  tatgactgct aaagcgatgt taccggaatt caacgctgta ggcgttggtg
     551  ataacgaaga cacttcgtcg gaatacccag taagtctgag tgtttccggt
     601  ggagttctcc gtgaacacca cttcatctga tt