Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone 50-23-1

ACC No: AJ579769

Dated: 2003-12-04 | Length: 632 | CRC: 741214588

                !!NA_SEQUENCE 1.0
ID   CTR579769  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579769;
XX
SV   AJ579769.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone 50-23-1
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6E0; Q7T6E0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Brazil"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="50-23-1"
FT                   /isolate="Galego-50"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6E0"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30351.1"
FT                   /translation="MDDTSGQTFISVDLSDESNTASTEVKTVSLEADRLEFLRKMNPFT
FT                   IDALIRKTNYQGARFRARIIGVCVDCGRKHNKGLRTERKCKVNNTQSQNEVAHMLMHNP
FT                   VEYLNKGKARAFSNAEMFAIDLVMYTKEKQSAVNLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKATLPDINAVDVGDNEDTSSEYPVSLSVSNGVLREHHFI"
XX
SQ   Sequence 632 BP; 193 A; 127 C; 158 G; 154 T; 0 other;

AJ579769  Length: 632  December 9, 2003 08:57  Type: N  Check: 8975  ..

       1  atggacgata ctagcggaca aactttcatt tctgtggacc tttctgacga
      51  aagcaacaca gctagcactg aagtcaaaac cgtaagtttg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttactatcga cgccttgata
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacaataa ggggttgagg accgaacgta
     251  aatgtaaggt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacaatc ccgttgagta tttaaataaa ggaaaggcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaggaaaagc
     401  agtcagcggt taatttagcc gctgaaaggg agaaaacgag actggctcgt
     451  agacacccga tgcgttctcc ggaggaaact ccggaacact ataaattcgg
     501  tatgactgct aaagcaacgt taccggatat caacgctgta gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tgtttctaac
     601  ggagttctcc gtgaacacca cttcatctga tt