Sequence of DPV Citrus tristeza virus

Citrus tristeza virus p23 gene, clone 268-23-29

ACC No: AJ579770

Dated: 2003-12-04 | Length: 632 | CRC: 800649599

                !!NA_SEQUENCE 1.0
ID   CTR579770  standard; genomic RNA; VRL; 632 BP.
XX
AC   AJ579770;
XX
SV   AJ579770.1
XX
DT   06-AUG-2003 (Rel. 76, Created)
DT   04-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE   Citrus tristeza virus p23 gene, clone 268-23-29
XX
KW   p23 gene; RNA binding protein.
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-632
RA   Sambade A.;
RT   ;
RL   Submitted (01-AUG-2003) to the EMBL/GenBank/DDBJ databases.
RL   , Proteccion Vegetal y Biotecnologia, Instituto Valenciano de
RL   Investigaciones Agrarias, Cra. Moncada-Naquera Km 4,5, Mocada, Valencia
RL   46113, Spain.
XX
RN   [2]
RA   Sambade A., Lopez C., Rubio L., Flores R., Guerri J., Moreno P.;
RT   "Polymorphism of a specific region in gene p23 of Citrus tristeza virus
RT   allows discrimination between mild and severe isolates";
RL   Arch. Virol. 148(12):2325-2340(2003).
XX
DR   SPTREMBL; Q7T6D9; Q7T6D9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .632
FT                   /country="Argentina"
FT                   /db_xref="taxon:12162"
FT                   /mol_type="genomic RNA"
FT                   /organism="Citrus tristeza virus"
FT                   /clone="268-23-29"
FT                   /isolate="C-268-2"
FT   CDS             1. .630
FT                   /db_xref="SPTREMBL:Q7T6D9"
FT                   /gene="p23"
FT                   /function="RNA binding protein"
FT                   /protein_id="CAE30352.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFV
FT                   IDALVRKTSYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
XX
SQ   Sequence 632 BP; 194 A; 125 C; 156 G; 157 T; 0 other;

AJ579770  Length: 632  December 9, 2003 08:57  Type: N  Check: 9581  ..

       1  atggatagta ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacgaaaa atgaacccct ttgtcatcga cgctttggta
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  atgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caacaataca caatctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt taatttagcc gctgaaaggg agaagacgag actagctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaacact ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgctgtg gacgttggtg
     551  ataacgagga tacttcgtca gagtacccag tgagtctgag tgtttctgac
     601  ggagttctcc gtgaacacca cttcatctga tt